Csa3G171840 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AATAATATCTATAAAGTTTCTTCCCATTAGTAAAGAAATAAGGCAAAAGAGAAAAGAAGTATGGAAAGTCAGAATAACAACACGAGAAAAAGAATCTCAAGCAAGCCAATGTCTTTACAGACTTGCTTTCTTCTTCTTCTCTTTCTCTTCCTCTTCCTCTTTCAAGATCTTTGTCTCGTTCGAGCTTCCTCCACACATTCTTGCAATGGCTCCATAGCCGCGTGTGCTAACGAGGAGGAGATGTTGATGGAGTCAGAGATAACTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCTATTGGAGCTTTAAAGAAGGATCACCCCGCTTGCGATGGCGCTAGTGGTGGCCAACCTTACACCAGAAGTGGAAGTTGTGCTCCGCCACCGGCTAATCCTTACAATCGAGGTTGCTCTAAGATATATCGTTGTAGGTCTGATGATTGAAGGTTTGATCAAACCATTGTATGGTTCATAGAATTTCTTCCTTTTTTCCTTTTCTC ATGGAAAGTCAGAATAACAACACGAGAAAAAGAATCTCAAGCAAGCCAATGTCTTTACAGACTTGCTTTCTTCTTCTTCTCTTTCTCTTCCTCTTCCTCTTTCAAGATCTTTGTCTCGTTCGAGCTTCCTCCACACATTCTTGCAATGGCTCCATAGCCGCGTGTGCTAACGAGGAGGAGATGTTGATGGAGTCAGAGATAACTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCTATTGGAGCTTTAAAGAAGGATCACCCCGCTTGCGATGGCGCTAGTGGTGGCCAACCTTACACCAGAAGTGGAAGTTGTGCTCCGCCACCGGCTAATCCTTACAATCGAGGTTGCTCTAAGATATATCGTTGTAGGTCTGATGATTGA ATGGAAAGTCAGAATAACAACACGAGAAAAAGAATCTCAAGCAAGCCAATGTCTTTACAGACTTGCTTTCTTCTTCTTCTCTTTCTCTTCCTCTTCCTCTTTCAAGATCTTTGTCTCGTTCGAGCTTCCTCCACACATTCTTGCAATGGCTCCATAGCCGCGTGTGCTAACGAGGAGGAGATGTTGATGGAGTCAGAGATAACTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCTATTGGAGCTTTAAAGAAGGATCACCCCGCTTGCGATGGCGCTAGTGGTGGCCAACCTTACACCAGAAGTGGAAGTTGTGCTCCGCCACCGGCTAATCCTTACAATCGAGGTTGCTCTAAGATATATCGTTGTAGGTCTGATGATTGA MESQNNNTRKRISSKPMSLQTCFLLLLFLFLFLFQDLCLVRASSTHSCNGSIAACANEEEMLMESEITRRFLEQQKKYISIGALKKDHPACDGASGGQPYTRSGSCAPPPANPYNRGCSKIYRCRSDD*
BLAST of Csa3G171840 vs. Swiss-Prot
Match: RLF32_ARATH (Protein RALF-like 32 OS=Arabidopsis thaliana GN=RALFL32 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 2.2e-18 Identity = 48/110 (43.64%), Postives = 64/110 (58.18%), Query Frame = 1
BLAST of Csa3G171840 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.0e-10 Identity = 45/117 (38.46%), Postives = 58/117 (49.57%), Query Frame = 1
BLAST of Csa3G171840 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.3e-10 Identity = 43/93 (46.24%), Postives = 52/93 (55.91%), Query Frame = 1
BLAST of Csa3G171840 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.5e-10 Identity = 47/120 (39.17%), Postives = 58/120 (48.33%), Query Frame = 1
BLAST of Csa3G171840 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-09 Identity = 43/87 (49.43%), Postives = 47/87 (54.02%), Query Frame = 1
BLAST of Csa3G171840 vs. TrEMBL
Match: A0A0A0L9A8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171840 PE=4 SV=1) HSP 1 Score: 266.9 bits (681), Expect = 1.3e-68 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 1
BLAST of Csa3G171840 vs. TrEMBL
Match: A0A0A0L624_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171850 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 4.8e-36 Identity = 84/102 (82.35%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Csa3G171840 vs. TrEMBL
Match: A0A0S3R1D3_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.01G214200 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 9.7e-29 Identity = 66/119 (55.46%), Postives = 88/119 (73.95%), Query Frame = 1
BLAST of Csa3G171840 vs. TrEMBL
Match: V7C8L1_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_003G051400g PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 2.2e-28 Identity = 63/118 (53.39%), Postives = 85/118 (72.03%), Query Frame = 1
BLAST of Csa3G171840 vs. TrEMBL
Match: B7FMN1_MEDTR (RALF OS=Medicago truncatula GN=MTR_8g083150 PE=2 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.8e-28 Identity = 64/117 (54.70%), Postives = 83/117 (70.94%), Query Frame = 1
BLAST of Csa3G171840 vs. TAIR10
Match: AT4G14010.1 (AT4G14010.1 ralf-like 32) HSP 1 Score: 93.2 bits (230), Expect = 1.3e-19 Identity = 48/110 (43.64%), Postives = 64/110 (58.18%), Query Frame = 1
BLAST of Csa3G171840 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 67.8 bits (164), Expect = 5.7e-12 Identity = 45/117 (38.46%), Postives = 58/117 (49.57%), Query Frame = 1
BLAST of Csa3G171840 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 67.4 bits (163), Expect = 7.4e-12 Identity = 43/93 (46.24%), Postives = 52/93 (55.91%), Query Frame = 1
BLAST of Csa3G171840 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 64.7 bits (156), Expect = 4.8e-11 Identity = 47/120 (39.17%), Postives = 58/120 (48.33%), Query Frame = 1
BLAST of Csa3G171840 vs. TAIR10
Match: AT4G13950.1 (AT4G13950.1 ralf-like 31) HSP 1 Score: 54.3 bits (129), Expect = 6.5e-08 Identity = 41/109 (37.61%), Postives = 48/109 (44.04%), Query Frame = 1
BLAST of Csa3G171840 vs. NCBI nr
Match: gi|778679218|ref|XP_004147646.2| (PREDICTED: protein RALF-like 32 [Cucumis sativus]) HSP 1 Score: 266.9 bits (681), Expect = 1.8e-68 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 1
BLAST of Csa3G171840 vs. NCBI nr
Match: gi|659077106|ref|XP_008439036.1| (PREDICTED: protein RALF-like 32 [Cucumis melo]) HSP 1 Score: 219.5 bits (558), Expect = 3.3e-54 Identity = 105/120 (87.50%), Postives = 113/120 (94.17%), Query Frame = 1
BLAST of Csa3G171840 vs. NCBI nr
Match: gi|700202095|gb|KGN57228.1| (hypothetical protein Csa_3G171850 [Cucumis sativus]) HSP 1 Score: 158.7 bits (400), Expect = 6.9e-36 Identity = 84/102 (82.35%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Csa3G171840 vs. NCBI nr
Match: gi|965658049|dbj|BAT74468.1| (hypothetical protein VIGAN_01214200 [Vigna angularis var. angularis]) HSP 1 Score: 134.4 bits (337), Expect = 1.4e-28 Identity = 66/119 (55.46%), Postives = 88/119 (73.95%), Query Frame = 1
BLAST of Csa3G171840 vs. NCBI nr
Match: gi|951070903|ref|XP_014490978.1| (PREDICTED: protein RALF-like 32 [Vigna radiata var. radiata]) HSP 1 Score: 134.0 bits (336), Expect = 1.8e-28 Identity = 67/119 (56.30%), Postives = 87/119 (73.11%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|