Carg15515 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGATGAGTTCTTGCAATGTCTCAATGGCCGAGCATGGTAACGAAGAGGAGCTGTTAGTGCAATCTGAGATGGGTAGAAGGTTTCTCGAAGAACAGAAGAAATATATCTCCATTGAAGCTTTAAAGAAGGATATGATAGCTTTTGAGGGTAGCAGCGGAGGGCAACCTTACCCCAAAAGCGAAAACTGTGCTCCCCCACCTCTTAATCCGTACAACCGAGGCTGCTCTAAAATATCTCGTTGTAGGTCTGATGATTGA ATGTCGATGAGTTCTTGCAATGTCTCAATGGCCGAGCATGGTAACGAAGAGGAGCTGTTAGTGCAATCTGAGATGGGTAGAAGGTTTCTCGAAGAACAGAAGAAATATATCTCCATTGAAGCTTTAAAGAAGGATATGATAGCTTTTGAGGGTAGCAGCGGAGGGCAACCTTACCCCAAAAGCGAAAACTGTGCTCCCCCACCTCTTAATCCGTACAACCGAGGCTGCTCTAAAATATCTCGTTGTAGGTCTGATGATTGA ATGTCGATGAGTTCTTGCAATGTCTCAATGGCCGAGCATGGTAACGAAGAGGAGCTGTTAGTGCAATCTGAGATGGGTAGAAGGTTTCTCGAAGAACAGAAGAAATATATCTCCATTGAAGCTTTAAAGAAGGATATGATAGCTTTTGAGGGTAGCAGCGGAGGGCAACCTTACCCCAAAAGCGAAAACTGTGCTCCCCCACCTCTTAATCCGTACAACCGAGGCTGCTCTAAAATATCTCGTTGTAGGTCTGATGATTGA MSMSSCNVSMAEHGNEEELLVQSEMGRRFLEEQKKYISIEALKKDMIAFEGSSGGQPYPKSENCAPPPLNPYNRGCSKISRCRSDD
BLAST of Carg15515 vs. NCBI nr
Match: XP_004147646.2 (PREDICTED: protein RALF-like 32 [Cucumis sativus] >KGN57227.1 hypothetical protein Csa_3G171840 [Cucumis sativus]) HSP 1 Score: 121.7 bits (304), Expect = 1.2e-24 Identity = 60/85 (70.59%), Postives = 70/85 (82.35%), Query Frame = 0
BLAST of Carg15515 vs. NCBI nr
Match: XP_023528073.1 (protein RALF-like 32 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 121.7 bits (304), Expect = 1.2e-24 Identity = 60/85 (70.59%), Postives = 68/85 (80.00%), Query Frame = 0
BLAST of Carg15515 vs. NCBI nr
Match: XP_022956250.1 (protein RALF-like 32 [Cucurbita moschata]) HSP 1 Score: 119.4 bits (298), Expect = 6.0e-24 Identity = 59/85 (69.41%), Postives = 67/85 (78.82%), Query Frame = 0
BLAST of Carg15515 vs. NCBI nr
Match: XP_022138047.1 (protein RALF-like 32 [Momordica charantia]) HSP 1 Score: 114.4 bits (285), Expect = 1.9e-22 Identity = 56/83 (67.47%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of Carg15515 vs. NCBI nr
Match: XP_022138044.1 (protein RALF-like 32 [Momordica charantia]) HSP 1 Score: 99.8 bits (247), Expect = 4.9e-18 Identity = 50/83 (60.24%), Postives = 63/83 (75.90%), Query Frame = 0
BLAST of Carg15515 vs. TAIR10
Match: AT4G14010.1 (ralf-like 32) HSP 1 Score: 59.7 bits (143), Expect = 1.0e-09 Identity = 36/89 (40.45%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of Carg15515 vs. TAIR10
Match: AT1G02900.1 (rapid alkalinization factor 1) HSP 1 Score: 52.8 bits (125), Expect = 1.3e-07 Identity = 36/81 (44.44%), Postives = 48/81 (59.26%), Query Frame = 0
BLAST of Carg15515 vs. TAIR10
Match: AT3G23805.1 (ralf-like 24) HSP 1 Score: 48.1 bits (113), Expect = 3.1e-06 Identity = 29/73 (39.73%), Postives = 41/73 (56.16%), Query Frame = 0
BLAST of Carg15515 vs. TAIR10
Match: AT4G13950.1 (ralf-like 31) HSP 1 Score: 48.1 bits (113), Expect = 3.1e-06 Identity = 26/70 (37.14%), Postives = 39/70 (55.71%), Query Frame = 0
BLAST of Carg15515 vs. TAIR10
Match: AT3G05490.1 (ralf-like 22) HSP 1 Score: 47.8 bits (112), Expect = 4.0e-06 Identity = 34/81 (41.98%), Postives = 46/81 (56.79%), Query Frame = 0
BLAST of Carg15515 vs. Swiss-Prot
Match: sp|O23262|RLF32_ARATH (Protein RALF-like 32 OS=Arabidopsis thaliana OX=3702 GN=RALFL32 PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.8e-08 Identity = 36/89 (40.45%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of Carg15515 vs. Swiss-Prot
Match: sp|Q9SRY3|RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.3e-06 Identity = 36/81 (44.44%), Postives = 48/81 (59.26%), Query Frame = 0
BLAST of Carg15515 vs. Swiss-Prot
Match: sp|Q945T0|RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.6e-05 Identity = 38/85 (44.71%), Postives = 45/85 (52.94%), Query Frame = 0
BLAST of Carg15515 vs. Swiss-Prot
Match: sp|Q9LK37|RLF24_ARATH (Protein RALF-like 24 OS=Arabidopsis thaliana OX=3702 GN=RALFL24 PE=3 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.6e-05 Identity = 29/73 (39.73%), Postives = 41/73 (56.16%), Query Frame = 0
BLAST of Carg15515 vs. Swiss-Prot
Match: sp|Q2HIM9|RLF31_ARATH (Protein RALF-like 31 OS=Arabidopsis thaliana OX=3702 GN=RALFL31 PE=3 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.6e-05 Identity = 26/70 (37.14%), Postives = 39/70 (55.71%), Query Frame = 0
BLAST of Carg15515 vs. TrEMBL
Match: tr|A0A0A0L9A8|A0A0A0L9A8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G171840 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 8.0e-25 Identity = 60/85 (70.59%), Postives = 70/85 (82.35%), Query Frame = 0
BLAST of Carg15515 vs. TrEMBL
Match: tr|A0A1S4C7B1|A0A1S4C7B1_TOBAC (protein RALF-like 32 OS=Nicotiana tabacum OX=4097 GN=LOC107815898 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 8.0e-17 Identity = 47/82 (57.32%), Postives = 58/82 (70.73%), Query Frame = 0
BLAST of Carg15515 vs. TrEMBL
Match: tr|A0A1U7WNT9|A0A1U7WNT9_NICSY (protein RALF-like 32 isoform X1 OS=Nicotiana sylvestris OX=4096 GN=LOC104226143 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 8.0e-17 Identity = 47/82 (57.32%), Postives = 58/82 (70.73%), Query Frame = 0
BLAST of Carg15515 vs. TrEMBL
Match: tr|I3RZ93|I3RZ93_LOTJA (Uncharacterized protein OS=Lotus japonicus OX=34305 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 1.0e-16 Identity = 48/82 (58.54%), Postives = 59/82 (71.95%), Query Frame = 0
BLAST of Carg15515 vs. TrEMBL
Match: tr|B7FMN1|B7FMN1_MEDTR (RALF OS=Medicago truncatula OX=3880 GN=11417972 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 48/82 (58.54%), Postives = 58/82 (70.73%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|