Carg24781 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACAACAAGAATCTCAAAATCTTGCTTTCTTCTCTTTCTCCTCCTCGTTCAAGATCTTTGTCTCGTTCGAGCTTCATCGAAGCACTCTTGCAATGGCTCGATAGCTGAGTGTGGTGGTGAAGAAGAGACGTTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGCACAGCAAAAGAAATATATCTCTATTGGAGCTTTGAAGAAGGATCACCCGGCTTGTGATGGCGGTGGTGGTGGTCAACCTTACACTAGAAGTGGAAGCTGCGCTCCGCCGCCAGCTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCTGACGATTGA ATGACAACAAGAATCTCAAAATCTTGCTTTCTTCTCTTTCTCCTCCTCGTTCAAGATCTTTGTCTCGTTCGAGCTTCATCGAAGCACTCTTGCAATGGCTCGATAGCTGAGTGTGGTGGTGAAGAAGAGACGTTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGCACAGCAAAAGAAATATATCTCTATTGGAGCTTTGAAGAAGGATCACCCGGCTTGTGATGGCGGTGGTGGTGGTCAACCTTACACTAGAAGTGGAAGCTGCGCTCCGCCGCCAGCTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCTGACGATTGA ATGACAACAAGAATCTCAAAATCTTGCTTTCTTCTCTTTCTCCTCCTCGTTCAAGATCTTTGTCTCGTTCGAGCTTCATCGAAGCACTCTTGCAATGGCTCGATAGCTGAGTGTGGTGGTGAAGAAGAGACGTTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGCACAGCAAAAGAAATATATCTCTATTGGAGCTTTGAAGAAGGATCACCCGGCTTGTGATGGCGGTGGTGGTGGTCAACCTTACACTAGAAGTGGAAGCTGCGCTCCGCCGCCAGCTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCTGACGATTGA MTTRISKSCFLLFLLLVQDLCLVRASSKHSCNGSIAECGGEEETLMESEISRRFLAQQKKYISIGALKKDHPACDGGGGGQPYTRSGSCAPPPANPYNRGCSKIYRCRSDD
BLAST of Carg24781 vs. NCBI nr
Match: XP_023528073.1 (protein RALF-like 32 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 229.2 bits (583), Expect = 7.0e-57 Identity = 110/111 (99.10%), Postives = 110/111 (99.10%), Query Frame = 0
BLAST of Carg24781 vs. NCBI nr
Match: XP_022956250.1 (protein RALF-like 32 [Cucurbita moschata]) HSP 1 Score: 226.9 bits (577), Expect = 3.5e-56 Identity = 108/111 (97.30%), Postives = 110/111 (99.10%), Query Frame = 0
BLAST of Carg24781 vs. NCBI nr
Match: XP_004147646.2 (PREDICTED: protein RALF-like 32 [Cucumis sativus] >KGN57227.1 hypothetical protein Csa_3G171840 [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 4.8e-42 Identity = 84/93 (90.32%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of Carg24781 vs. NCBI nr
Match: XP_022138047.1 (protein RALF-like 32 [Momordica charantia]) HSP 1 Score: 169.9 bits (429), Expect = 5.0e-39 Identity = 82/106 (77.36%), Postives = 89/106 (83.96%), Query Frame = 0
BLAST of Carg24781 vs. NCBI nr
Match: KGN57228.1 (hypothetical protein Csa_3G171850 [Cucumis sativus]) HSP 1 Score: 133.3 bits (334), Expect = 5.2e-28 Identity = 71/98 (72.45%), Postives = 76/98 (77.55%), Query Frame = 0
BLAST of Carg24781 vs. TAIR10
Match: AT4G14010.1 (ralf-like 32) HSP 1 Score: 94.4 bits (233), Expect = 4.9e-20 Identity = 52/113 (46.02%), Postives = 68/113 (60.18%), Query Frame = 0
BLAST of Carg24781 vs. TAIR10
Match: AT1G02900.1 (rapid alkalinization factor 1) HSP 1 Score: 71.2 bits (173), Expect = 4.4e-13 Identity = 41/79 (51.90%), Postives = 51/79 (64.56%), Query Frame = 0
BLAST of Carg24781 vs. TAIR10
Match: AT3G05490.1 (ralf-like 22) HSP 1 Score: 69.7 bits (169), Expect = 1.3e-12 Identity = 45/93 (48.39%), Postives = 55/93 (59.14%), Query Frame = 0
BLAST of Carg24781 vs. TAIR10
Match: AT4G15800.1 (ralf-like 33) HSP 1 Score: 67.4 bits (163), Expect = 6.3e-12 Identity = 41/81 (50.62%), Postives = 49/81 (60.49%), Query Frame = 0
BLAST of Carg24781 vs. TAIR10
Match: AT3G16570.1 (rapid alkalinization factor 23) HSP 1 Score: 59.7 bits (143), Expect = 1.3e-09 Identity = 41/95 (43.16%), Postives = 51/95 (53.68%), Query Frame = 0
BLAST of Carg24781 vs. Swiss-Prot
Match: sp|O23262|RLF32_ARATH (Protein RALF-like 32 OS=Arabidopsis thaliana OX=3702 GN=RALFL32 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 8.7e-19 Identity = 52/113 (46.02%), Postives = 68/113 (60.18%), Query Frame = 0
BLAST of Carg24781 vs. Swiss-Prot
Match: sp|Q9SRY3|RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.9e-12 Identity = 41/79 (51.90%), Postives = 51/79 (64.56%), Query Frame = 0
BLAST of Carg24781 vs. Swiss-Prot
Match: sp|Q9MA62|RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.3e-11 Identity = 45/93 (48.39%), Postives = 55/93 (59.14%), Query Frame = 0
BLAST of Carg24781 vs. Swiss-Prot
Match: sp|Q945T0|RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.1e-10 Identity = 42/86 (48.84%), Postives = 50/86 (58.14%), Query Frame = 0
BLAST of Carg24781 vs. Swiss-Prot
Match: sp|Q8L9P8|RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.1e-10 Identity = 41/81 (50.62%), Postives = 49/81 (60.49%), Query Frame = 0
BLAST of Carg24781 vs. TrEMBL
Match: tr|A0A0A0L9A8|A0A0A0L9A8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G171840 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 3.2e-42 Identity = 84/93 (90.32%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of Carg24781 vs. TrEMBL
Match: tr|A0A0A0L624|A0A0A0L624_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G171850 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 3.4e-28 Identity = 71/98 (72.45%), Postives = 76/98 (77.55%), Query Frame = 0
BLAST of Carg24781 vs. TrEMBL
Match: tr|A0A2P6QW25|A0A2P6QW25_ROSCH (Putative rapid ALkalinization Factor OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0413341 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.3e-27 Identity = 66/105 (62.86%), Postives = 78/105 (74.29%), Query Frame = 0
BLAST of Carg24781 vs. TrEMBL
Match: tr|C6T1A5|C6T1A5_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100500295 PE=2 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 2.9e-27 Identity = 64/112 (57.14%), Postives = 80/112 (71.43%), Query Frame = 0
BLAST of Carg24781 vs. TrEMBL
Match: tr|A0A1S4C7B1|A0A1S4C7B1_TOBAC (protein RALF-like 32 OS=Nicotiana tabacum OX=4097 GN=LOC107815898 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.0e-27 Identity = 63/101 (62.38%), Postives = 76/101 (75.25%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|