Cla97C05G088730 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTGATGGAGTCGGAAATAAGTCAAAGGTTTCTTGAACAACAAAGGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGCAGCGGTGGCGGTCAACCATACACAAAAAGCGGAAGCTGCGCTCCGCCGCCAACCAATCCTTACAATCGAGGCTGCTCGAAGATATATCGTTGTAGGTCTGATGATTGA ATGCTGATGGAGTCGGAAATAAGTCAAAGGTTTCTTGAACAACAAAGGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGCAGCGGTGGCGGTCAACCATACACAAAAAGCGGAAGCTGCGCTCCGCCGCCAACCAATCCTTACAATCGAGGCTGCTCGAAGATATATCGTTGTAGGTCTGATGATTGA ATGCTGATGGAGTCGGAAATAAGTCAAAGGTTTCTTGAACAACAAAGGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGCAGCGGTGGCGGTCAACCATACACAAAAAGCGGAAGCTGCGCTCCGCCGCCAACCAATCCTTACAATCGAGGCTGCTCGAAGATATATCGTTGTAGGTCTGATGATTGA MLMESEISQRFLEQQRKYISIGALKKDHPACDGSGGGQPYTKSGSCAPPPTNPYNRGCSKIYRCRSDD
BLAST of Cla97C05G088730 vs. NCBI nr
Match: XP_023528073.1 (protein RALF-like 32 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 137.9 bits (346), Expect = 1.3e-29 Identity = 62/67 (92.54%), Postives = 65/67 (97.01%), Query Frame = 0
BLAST of Cla97C05G088730 vs. NCBI nr
Match: XP_022956250.1 (protein RALF-like 32 [Cucurbita moschata]) HSP 1 Score: 136.7 bits (343), Expect = 2.9e-29 Identity = 62/67 (92.54%), Postives = 64/67 (95.52%), Query Frame = 0
BLAST of Cla97C05G088730 vs. NCBI nr
Match: XP_004147646.2 (PREDICTED: protein RALF-like 32 [Cucumis sativus] >KGN57227.1 hypothetical protein Csa_3G171840 [Cucumis sativus]) HSP 1 Score: 136.3 bits (342), Expect = 3.8e-29 Identity = 61/68 (89.71%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of Cla97C05G088730 vs. NCBI nr
Match: XP_022138047.1 (protein RALF-like 32 [Momordica charantia]) HSP 1 Score: 132.9 bits (333), Expect = 4.2e-28 Identity = 61/68 (89.71%), Postives = 65/68 (95.59%), Query Frame = 0
BLAST of Cla97C05G088730 vs. NCBI nr
Match: PHU24675.1 (hypothetical protein BC332_09782 [Capsicum chinense]) HSP 1 Score: 106.3 bits (264), Expect = 4.2e-20 Identity = 47/67 (70.15%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TrEMBL
Match: tr|A0A0A0L9A8|A0A0A0L9A8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G171840 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 2.5e-29 Identity = 61/68 (89.71%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TrEMBL
Match: tr|A0A2G3D120|A0A2G3D120_CAPCH (Uncharacterized protein OS=Capsicum chinense OX=80379 GN=BC332_09782 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.8e-20 Identity = 47/67 (70.15%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TrEMBL
Match: tr|C6T1A5|C6T1A5_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100500295 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 6.1e-20 Identity = 46/67 (68.66%), Postives = 56/67 (83.58%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TrEMBL
Match: tr|A0A1U8G9R6|A0A1U8G9R6_CAPAN (protein RALF-like 32 OS=Capsicum annuum OX=4072 GN=LOC107866560 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 6.1e-20 Identity = 46/67 (68.66%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TrEMBL
Match: tr|A0A2G2W263|A0A2G2W263_CAPBA (Uncharacterized protein OS=Capsicum baccatum OX=33114 GN=CQW23_22893 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 6.1e-20 Identity = 46/67 (68.66%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of Cla97C05G088730 vs. Swiss-Prot
Match: sp|O23262|RLF32_ARATH (Protein RALF-like 32 OS=Arabidopsis thaliana OX=3702 GN=RALFL32 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-13 Identity = 36/67 (53.73%), Postives = 46/67 (68.66%), Query Frame = 0
BLAST of Cla97C05G088730 vs. Swiss-Prot
Match: sp|Q945T0|RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 3.4e-05 Identity = 29/64 (45.31%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of Cla97C05G088730 vs. Swiss-Prot
Match: sp|Q9SRY3|RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 3.4e-05 Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of Cla97C05G088730 vs. Swiss-Prot
Match: sp|Q9MA62|RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 4.4e-05 Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of Cla97C05G088730 vs. Swiss-Prot
Match: sp|Q9LUS7|RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana OX=3702 GN=RALF23 PE=1 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 5.8e-05 Identity = 28/63 (44.44%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TAIR10
Match: AT4G14010.1 (ralf-like 32) HSP 1 Score: 75.1 bits (183), Expect = 1.9e-14 Identity = 36/67 (53.73%), Postives = 46/67 (68.66%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TAIR10
Match: AT1G02900.1 (rapid alkalinization factor 1) HSP 1 Score: 48.5 bits (114), Expect = 1.9e-06 Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TAIR10
Match: AT3G05490.1 (ralf-like 22) HSP 1 Score: 48.1 bits (113), Expect = 2.4e-06 Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TAIR10
Match: AT3G16570.1 (rapid alkalinization factor 23) HSP 1 Score: 47.8 bits (112), Expect = 3.2e-06 Identity = 28/63 (44.44%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Cla97C05G088730 vs. TAIR10
Match: AT3G23805.1 (ralf-like 24) HSP 1 Score: 47.4 bits (111), Expect = 4.2e-06 Identity = 26/66 (39.39%), Postives = 35/66 (53.03%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|