Cp4.1LG08g05550 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGATGAGTTCTTGCAATGTCTCAATGGCCGAACATGGTAACGAAGAGGAGCTGTTAGTGCAATCTGAGATAGGTAGAAGGTTTCTCGAAGAACAAAAGAAATATATCTCCATTGGAGCTTTAAAGAAGGATATGATAGCTTTTGATGGTAGCAGCGGAGGCCAACCTTACACCAAAAGTGAAAATTGTGTTCCCCCACCTCTTAATCCGTACAACCGAGGCTGCTCTAAAATATCTCGTTGTAGGTCTGATGATTGA ATGTCGATGAGTTCTTGCAATGTCTCAATGGCCGAACATGGTAACGAAGAGGAGCTGTTAGTGCAATCTGAGATAGGTAGAAGGTTTCTCGAAGAACAAAAGAAATATATCTCCATTGGAGCTTTAAAGAAGGATATGATAGCTTTTGATGGTAGCAGCGGAGGCCAACCTTACACCAAAAGTGAAAATTGTGTTCCCCCACCTCTTAATCCGTACAACCGAGGCTGCTCTAAAATATCTCGTTGTAGGTCTGATGATTGA ATGTCGATGAGTTCTTGCAATGTCTCAATGGCCGAACATGGTAACGAAGAGGAGCTGTTAGTGCAATCTGAGATAGGTAGAAGGTTTCTCGAAGAACAAAAGAAATATATCTCCATTGGAGCTTTAAAGAAGGATATGATAGCTTTTGATGGTAGCAGCGGAGGCCAACCTTACACCAAAAGTGAAAATTGTGTTCCCCCACCTCTTAATCCGTACAACCGAGGCTGCTCTAAAATATCTCGTTGTAGGTCTGATGATTGA MSMSSCNVSMAEHGNEEELLVQSEIGRRFLEEQKKYISIGALKKDMIAFDGSSGGQPYTKSENCVPPPLNPYNRGCSKISRCRSDD
BLAST of Cp4.1LG08g05550 vs. Swiss-Prot
Match: RLF32_ARATH (Protein RALF-like 32 OS=Arabidopsis thaliana GN=RALFL32 PE=3 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.5e-10 Identity = 38/89 (42.70%), Postives = 52/89 (58.43%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.9e-06 Identity = 36/81 (44.44%), Postives = 46/81 (56.79%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.8e-06 Identity = 35/81 (43.21%), Postives = 46/81 (56.79%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 5.0e-06 Identity = 39/85 (45.88%), Postives = 46/85 (54.12%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TrEMBL
Match: A0A0A0L9A8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171840 PE=4 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 9.3e-28 Identity = 63/85 (74.12%), Postives = 71/85 (83.53%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TrEMBL
Match: I3RZ93_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.6e-19 Identity = 50/82 (60.98%), Postives = 63/82 (76.83%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TrEMBL
Match: B7FMN1_MEDTR (RALF OS=Medicago truncatula GN=MTR_8g083150 PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.6e-19 Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TrEMBL
Match: C6T1A5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_05G151400 PE=2 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.4e-18 Identity = 46/82 (56.10%), Postives = 61/82 (74.39%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TrEMBL
Match: A0A072TUW6_MEDTR (RALF OS=Medicago truncatula GN=MTR_8g083150 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.3e-18 Identity = 48/80 (60.00%), Postives = 60/80 (75.00%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TAIR10
Match: AT4G14010.1 (AT4G14010.1 ralf-like 32) HSP 1 Score: 66.6 bits (161), Expect = 8.4e-12 Identity = 38/89 (42.70%), Postives = 52/89 (58.43%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 52.4 bits (124), Expect = 1.6e-07 Identity = 36/81 (44.44%), Postives = 46/81 (56.79%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 52.0 bits (123), Expect = 2.1e-07 Identity = 35/81 (43.21%), Postives = 46/81 (56.79%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 48.1 bits (113), Expect = 3.1e-06 Identity = 35/83 (42.17%), Postives = 44/83 (53.01%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. TAIR10
Match: AT4G13950.1 (AT4G13950.1 ralf-like 31) HSP 1 Score: 47.8 bits (112), Expect = 4.0e-06 Identity = 26/70 (37.14%), Postives = 37/70 (52.86%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. NCBI nr
Match: gi|778679218|ref|XP_004147646.2| (PREDICTED: protein RALF-like 32 [Cucumis sativus]) HSP 1 Score: 130.6 bits (327), Expect = 1.3e-27 Identity = 63/85 (74.12%), Postives = 71/85 (83.53%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. NCBI nr
Match: gi|659077106|ref|XP_008439036.1| (PREDICTED: protein RALF-like 32 [Cucumis melo]) HSP 1 Score: 126.3 bits (316), Expect = 2.5e-26 Identity = 60/85 (70.59%), Postives = 71/85 (83.53%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. NCBI nr
Match: gi|357518655|ref|XP_003629616.1| (RALF [Medicago truncatula]) HSP 1 Score: 103.2 bits (256), Expect = 2.3e-19 Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. NCBI nr
Match: gi|388490538|gb|AFK33335.1| (unknown [Lotus japonicus]) HSP 1 Score: 103.2 bits (256), Expect = 2.3e-19 Identity = 50/82 (60.98%), Postives = 63/82 (76.83%), Query Frame = 1
BLAST of Cp4.1LG08g05550 vs. NCBI nr
Match: gi|697103835|ref|XP_009605720.1| (PREDICTED: protein RALF-like 32 [Nicotiana tomentosiformis]) HSP 1 Score: 103.2 bits (256), Expect = 2.3e-19 Identity = 49/82 (59.76%), Postives = 62/82 (75.61%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|