CmaCh14G008490 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGAGAGTGACATAAGCGCAGCCGAGTGCGAGAGGATCTTCAAGCGATTCGACGCGAACGGCGACGGGATGATATCGGCGGCGGAGCTGGGCGATGCGTTGAACGGATTGGGAGTGAACGCGGAGGAGGCGAAGAGGATGATGGACGCGATTGACAAAGACGGCGATGGGTTCATATCGTGGGAAGAGTTCGCGGATTTCACCAAGGAAAATCGCGCGTTGATGAAAGATTTTGCGAAGGCGTTTTAA ATGGCGGAGAGTGACATAAGCGCAGCCGAGTGCGAGAGGATCTTCAAGCGATTCGACGCGAACGGCGACGGGATGATATCGGCGGCGGAGCTGGGCGATGCGTTGAACGGATTGGGAGTGAACGCGGAGGAGGCGAAGAGGATGATGGACGCGATTGACAAAGACGGCGATGGGTTCATATCGTGGGAAGAGTTCGCGGATTTCACCAAGGAAAATCGCGCGTTGATGAAAGATTTTGCGAAGGCGTTTTAA ATGGCGGAGAGTGACATAAGCGCAGCCGAGTGCGAGAGGATCTTCAAGCGATTCGACGCGAACGGCGACGGGATGATATCGGCGGCGGAGCTGGGCGATGCGTTGAACGGATTGGGAGTGAACGCGGAGGAGGCGAAGAGGATGATGGACGCGATTGACAAAGACGGCGATGGGTTCATATCGTGGGAAGAGTTCGCGGATTTCACCAAGGAAAATCGCGCGTTGATGAAAGATTTTGCGAAGGCGTTTTAA MAESDISAAECERIFKRFDANGDGMISAAELGDALNGLGVNAEEAKRMMDAIDKDGDGFISWEEFADFTKENRALMKDFAKAF
BLAST of CmaCh14G008490 vs. Swiss-Prot
Match: CML28_ARATH (Probable calcium-binding protein CML28 OS=Arabidopsis thaliana GN=CML28 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.0e-20 Identity = 52/76 (68.42%), Postives = 58/76 (76.32%), Query Frame = 1
BLAST of CmaCh14G008490 vs. Swiss-Prot
Match: POLC2_BRACM (Polcalcin Bra r 2 OS=Brassica campestris PE=1 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 5.8e-20 Identity = 50/76 (65.79%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of CmaCh14G008490 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 5.8e-20 Identity = 51/76 (67.11%), Postives = 58/76 (76.32%), Query Frame = 1
BLAST of CmaCh14G008490 vs. Swiss-Prot
Match: POLC2_BRANA (Polcalcin Bra n 2 OS=Brassica napus PE=1 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 5.8e-20 Identity = 50/76 (65.79%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of CmaCh14G008490 vs. Swiss-Prot
Match: ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea GN=OLE3 PE=1 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.7e-19 Identity = 52/84 (61.90%), Postives = 60/84 (71.43%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TrEMBL
Match: A0A0A0L775_CUCSA (Putative calcium-binding protein CML28 OS=Cucumis sativus GN=Csa_3G345360 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 6.9e-28 Identity = 63/83 (75.90%), Postives = 75/83 (90.36%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TrEMBL
Match: I1MBX4_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_14G216000 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.4e-20 Identity = 55/84 (65.48%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TrEMBL
Match: A0A0B2S5H4_GLYSO (Polcalcin Nic t 1 OS=Glycine soja GN=glysoja_016839 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.4e-20 Identity = 55/84 (65.48%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TrEMBL
Match: G7K1Y2_MEDTR (EF hand calcium-binding family protein OS=Medicago truncatula GN=MTR_5g079470 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 9.0e-20 Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TrEMBL
Match: A0A0A0KQB8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G420320 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.2e-19 Identity = 55/84 (65.48%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TAIR10
Match: AT3G03430.1 (AT3G03430.1 Calcium-binding EF-hand family protein) HSP 1 Score: 99.4 bits (246), Expect = 1.1e-21 Identity = 52/76 (68.42%), Postives = 58/76 (76.32%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TAIR10
Match: AT5G17480.1 (AT5G17480.1 pollen calcium-binding protein 1) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-19 Identity = 50/76 (65.79%), Postives = 57/76 (75.00%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TAIR10
Match: AT1G73630.1 (AT1G73630.1 EF hand calcium-binding protein family) HSP 1 Score: 62.0 bits (149), Expect = 2.0e-10 Identity = 30/70 (42.86%), Postives = 46/70 (65.71%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 58.9 bits (141), Expect = 1.7e-09 Identity = 29/60 (48.33%), Postives = 41/60 (68.33%), Query Frame = 1
BLAST of CmaCh14G008490 vs. TAIR10
Match: AT1G66400.1 (AT1G66400.1 calmodulin like 23) HSP 1 Score: 57.0 bits (136), Expect = 6.4e-09 Identity = 33/84 (39.29%), Postives = 45/84 (53.57%), Query Frame = 1
BLAST of CmaCh14G008490 vs. NCBI nr
Match: gi|659114464|ref|XP_008457063.1| (PREDICTED: polcalcin Bra n 2-like [Cucumis melo]) HSP 1 Score: 139.0 bits (349), Expect = 3.6e-30 Identity = 65/83 (78.31%), Postives = 78/83 (93.98%), Query Frame = 1
BLAST of CmaCh14G008490 vs. NCBI nr
Match: gi|449464146|ref|XP_004149790.1| (PREDICTED: probable calcium-binding protein CML28 [Cucumis sativus]) HSP 1 Score: 131.0 bits (328), Expect = 9.9e-28 Identity = 63/83 (75.90%), Postives = 75/83 (90.36%), Query Frame = 1
BLAST of CmaCh14G008490 vs. NCBI nr
Match: gi|356553301|ref|XP_003544995.1| (PREDICTED: polcalcin Nic t 1 [Glycine max]) HSP 1 Score: 106.7 bits (265), Expect = 2.0e-20 Identity = 55/84 (65.48%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of CmaCh14G008490 vs. NCBI nr
Match: gi|357492167|ref|XP_003616372.1| (EF hand calcium-binding family protein [Medicago truncatula]) HSP 1 Score: 104.0 bits (258), Expect = 1.3e-19 Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of CmaCh14G008490 vs. NCBI nr
Match: gi|593490053|ref|XP_007141894.1| (hypothetical protein PHAVU_008G234700g [Phaseolus vulgaris]) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|