CsGy3G020960 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGACAGTGGCGTAAACTCAGCCGATTTGGAGAGAATTTTCAAACGATTCGATGCCAATGGCGACGGCAAGATCTCGGCAACAGAGCTGGGAGATGCTTTGAACGAGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGTGATGGCTACATTTCCTTCCAAGAATTCTTTGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAG ATGGCAGACAGTGGCGTAAACTCAGCCGATTTGGAGAGAATTTTCAAACGATTCGATGCCAATGGCGACGGCAAGATCTCGGCAACAGAGCTGGGAGATGCTTTGAACGAGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGTGATGGCTACATTTCCTTCCAAGAATTCTTTGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAG ATGGCAGACAGTGGCGTAAACTCAGCCGATTTGGAGAGAATTTTCAAACGATTCGATGCCAATGGCGACGGCAAGATCTCGGCAACAGAGCTGGGAGATGCTTTGAACGAGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGTGATGGCTACATTTCCTTCCAAGAATTCTTTGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAG MADSGVNSADLERIFKRFDANGDGKISATELGDALNEFGVSSEDAKRMMDAIDKDGDGYISFQEFFDFAKDNRALMKDFAKAF
BLAST of CsGy3G020960 vs. NCBI nr
Match: XP_004149790.1 (PREDICTED: probable calcium-binding protein CML28 [Cucumis sativus] >KGN57835.1 putative calcium-binding protein CML28 [Cucumis sativus]) HSP 1 Score: 90.5 bits (223), Expect = 2.9e-15 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of CsGy3G020960 vs. NCBI nr
Match: XP_016902062.1 (PREDICTED: polcalcin Bra n 2-like [Cucumis melo]) HSP 1 Score: 88.6 bits (218), Expect = 1.1e-14 Identity = 81/83 (97.59%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of CsGy3G020960 vs. NCBI nr
Match: XP_022948513.1 (probable calcium-binding protein CML28 [Cucurbita moschata] >XP_022998721.1 probable calcium-binding protein CML28 [Cucurbita maxima] >XP_023523664.1 probable calcium-binding protein CML28 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 82.4 bits (202), Expect = 7.9e-13 Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of CsGy3G020960 vs. NCBI nr
Match: XP_022982739.1 (polcalcin Syr v 3-like [Cucurbita maxima]) HSP 1 Score: 72.0 bits (175), Expect = 1.1e-09 Identity = 68/83 (81.93%), Postives = 74/83 (89.16%), Query Frame = 0
BLAST of CsGy3G020960 vs. NCBI nr
Match: XP_023526616.1 (probable calcium-binding protein CML28 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 72.0 bits (175), Expect = 1.1e-09 Identity = 70/83 (84.34%), Postives = 74/83 (89.16%), Query Frame = 0
BLAST of CsGy3G020960 vs. TAIR10
Match: AT3G03430.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 53.1 bits (126), Expect = 9.3e-08 Identity = 36/84 (42.86%), Postives = 40/84 (47.62%), Query Frame = 0
BLAST of CsGy3G020960 vs. TAIR10
Match: AT5G17480.1 (pollen calcium-binding protein 1) HSP 1 Score: 45.1 bits (105), Expect = 2.5e-05 Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of CsGy3G020960 vs. Swiss-Prot
Match: sp|P69199|POLC2_BRACM (Polcalcin Bra r 2 OS=Brassica campestris OX=3711 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.3e-06 Identity = 51/84 (60.71%), Postives = 56/84 (66.67%), Query Frame = 0
BLAST of CsGy3G020960 vs. Swiss-Prot
Match: sp|P69198|POLC2_BRANA (Polcalcin Bra n 2 OS=Brassica napus OX=3708 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.3e-06 Identity = 51/84 (60.71%), Postives = 56/84 (66.67%), Query Frame = 0
BLAST of CsGy3G020960 vs. Swiss-Prot
Match: sp|Q9SRP7|CML28_ARATH (Probable calcium-binding protein CML28 OS=Arabidopsis thaliana OX=3702 GN=CML28 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.7e-06 Identity = 36/84 (42.86%), Postives = 40/84 (47.62%), Query Frame = 0
BLAST of CsGy3G020960 vs. Swiss-Prot
Match: sp|Q8VWY7|POLC2_TOBAC (Polcalcin Nic t 2 OS=Nicotiana tabacum OX=4097 GN=Nict2 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 4.9e-06 Identity = 25/34 (73.53%), Postives = 28/34 (82.35%), Query Frame = 0
BLAST of CsGy3G020960 vs. Swiss-Prot
Match: sp|Q84V36|POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album OX=3559 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 8.3e-06 Identity = 24/33 (72.73%), Postives = 28/33 (84.85%), Query Frame = 0
BLAST of CsGy3G020960 vs. TrEMBL
Match: tr|A0A0A0L775|A0A0A0L775_CUCSA (Putative calcium-binding protein CML28 OS=Cucumis sativus OX=3659 GN=Csa_3G345360 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.9e-15 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of CsGy3G020960 vs. TrEMBL
Match: tr|A0A1S4E1G1|A0A1S4E1G1_CUCME (polcalcin Bra n 2-like OS=Cucumis melo OX=3656 GN=LOC103496835 PE=4 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 7.3e-15 Identity = 81/83 (97.59%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of CsGy3G020960 vs. TrEMBL
Match: tr|A0A2G9HP39|A0A2G9HP39_9LAMI (Uncharacterized protein OS=Handroanthus impetiginosus OX=429701 GN=CDL12_08025 PE=4 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.8e-05 Identity = 28/35 (80.00%), Postives = 30/35 (85.71%), Query Frame = 0
BLAST of CsGy3G020960 vs. TrEMBL
Match: tr|A0A2P5E779|A0A2P5E779_9ROSA (Parvalbumin OS=Trema orientalis OX=63057 GN=TorRG33x02_228240 PE=4 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 4.0e-05 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of CsGy3G020960 vs. TrEMBL
Match: tr|A0A2P4GR13|A0A2P4GR13_QUESU (Polcalcin bet v 4 OS=Quercus suber OX=58331 GN=CFP56_56695 PE=4 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 4.0e-05 Identity = 27/35 (77.14%), Postives = 28/35 (80.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|