Csa3G345360 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GAAGAAGAGAAGAAAGAAAGAGCAAAAAAAAAAAAAAAAAAGTGTGATTGCCCTAAGTTCAAGATCAATTATCCATTTCAGAATTAGCTGCACAAAAATGGCAGACAGTGGCGTAAACTCAGCCGATTTGGAGAGAATTTTCAAACGATTCGATGCCAATGGCGATGGCAAGATCTCGGCAACAGAGCTGGGAGATGCTTTGAACGAGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGTGATGGCTACATTTCCTTCCAAGAATTCTTTGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAGATTTTTTTATTTTAATGGAAGGATCTGATTATATGAATATGGTTACCGTGAAGGAGACGCTTCTTCTTCCTTTTGTTTTTTCTTTCTTTTGTACCACACACACACATATATAAACATAACATATACTGTGCTTCTCTTCATGAACGTTATAAATGTTATATTTTTCGATTAAGTTTCATTTTCATTTCTAAACTTTA ATGGCAGACAGTGGCGTAAACTCAGCCGATTTGGAGAGAATTTTCAAACGATTCGATGCCAATGGCGATGGCAAGATCTCGGCAACAGAGCTGGGAGATGCTTTGAACGAGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGTGATGGCTACATTTCCTTCCAAGAATTCTTTGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAG ATGGCAGACAGTGGCGTAAACTCAGCCGATTTGGAGAGAATTTTCAAACGATTCGATGCCAATGGCGATGGCAAGATCTCGGCAACAGAGCTGGGAGATGCTTTGAACGAGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGTGATGGCTACATTTCCTTCCAAGAATTCTTTGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAG MADSGVNSADLERIFKRFDANGDGKISATELGDALNEFGVSSEDAKRMMDAIDKDGDGYISFQEFFDFAKDNRALMKDFAKAF*
BLAST of Csa3G345360 vs. Swiss-Prot
Match: CML28_ARATH (Probable calcium-binding protein CML28 OS=Arabidopsis thaliana GN=CML28 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 7.4e-23 Identity = 57/84 (67.86%), Postives = 61/84 (72.62%), Query Frame = 1
BLAST of Csa3G345360 vs. Swiss-Prot
Match: POLC2_BRACM (Polcalcin Bra r 2 OS=Brassica campestris PE=1 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.2e-22 Identity = 56/84 (66.67%), Postives = 62/84 (73.81%), Query Frame = 1
BLAST of Csa3G345360 vs. Swiss-Prot
Match: POLC2_BRANA (Polcalcin Bra n 2 OS=Brassica napus PE=1 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.2e-22 Identity = 56/84 (66.67%), Postives = 62/84 (73.81%), Query Frame = 1
BLAST of Csa3G345360 vs. Swiss-Prot
Match: POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.6e-20 Identity = 50/82 (60.98%), Postives = 60/82 (73.17%), Query Frame = 1
BLAST of Csa3G345360 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.6e-20 Identity = 50/82 (60.98%), Postives = 58/82 (70.73%), Query Frame = 1
BLAST of Csa3G345360 vs. TrEMBL
Match: A0A0A0L775_CUCSA (Putative calcium-binding protein CML28 OS=Cucumis sativus GN=Csa_3G345360 PE=4 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 6.7e-39 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 1
BLAST of Csa3G345360 vs. TrEMBL
Match: A0A067KMY8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13424 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.3e-21 Identity = 56/84 (66.67%), Postives = 61/84 (72.62%), Query Frame = 1
BLAST of Csa3G345360 vs. TrEMBL
Match: A0A0B2S5H4_GLYSO (Polcalcin Nic t 1 OS=Glycine soja GN=glysoja_016839 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-20 Identity = 54/84 (64.29%), Postives = 66/84 (78.57%), Query Frame = 1
BLAST of Csa3G345360 vs. TrEMBL
Match: I1MBX4_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_14G216000 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-20 Identity = 54/84 (64.29%), Postives = 66/84 (78.57%), Query Frame = 1
BLAST of Csa3G345360 vs. TrEMBL
Match: D7L0H4_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_896345 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.4e-20 Identity = 57/84 (67.86%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Csa3G345360 vs. TAIR10
Match: AT3G03430.1 (AT3G03430.1 Calcium-binding EF-hand family protein) HSP 1 Score: 107.5 bits (267), Expect = 4.2e-24 Identity = 57/84 (67.86%), Postives = 61/84 (72.62%), Query Frame = 1
BLAST of Csa3G345360 vs. TAIR10
Match: AT5G17480.1 (AT5G17480.1 pollen calcium-binding protein 1) HSP 1 Score: 97.4 bits (241), Expect = 4.3e-21 Identity = 53/84 (63.10%), Postives = 60/84 (71.43%), Query Frame = 1
BLAST of Csa3G345360 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 64.3 bits (155), Expect = 4.1e-11 Identity = 32/79 (40.51%), Postives = 47/79 (59.49%), Query Frame = 1
HSP 2 Score: 48.9 bits (115), Expect = 1.8e-06 Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 1
BLAST of Csa3G345360 vs. TAIR10
Match: AT3G07490.1 (AT3G07490.1 ARF-GAP domain 11) HSP 1 Score: 61.6 bits (148), Expect = 2.6e-10 Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 1
HSP 2 Score: 50.1 bits (118), Expect = 7.9e-07 Identity = 26/65 (40.00%), Postives = 32/65 (49.23%), Query Frame = 1
BLAST of Csa3G345360 vs. TAIR10
Match: AT2G15680.1 (AT2G15680.1 Calcium-binding EF-hand family protein) HSP 1 Score: 61.2 bits (147), Expect = 3.4e-10 Identity = 31/70 (44.29%), Postives = 39/70 (55.71%), Query Frame = 1
HSP 2 Score: 55.8 bits (133), Expect = 1.4e-08 Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 1
HSP 3 Score: 38.1 bits (87), Expect = 3.1e-03 Identity = 22/56 (39.29%), Postives = 27/56 (48.21%), Query Frame = 1
BLAST of Csa3G345360 vs. NCBI nr
Match: gi|449464146|ref|XP_004149790.1| (PREDICTED: probable calcium-binding protein CML28 [Cucumis sativus]) HSP 1 Score: 167.5 bits (423), Expect = 9.7e-39 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 1
BLAST of Csa3G345360 vs. NCBI nr
Match: gi|659114464|ref|XP_008457063.1| (PREDICTED: polcalcin Bra n 2-like [Cucumis melo]) HSP 1 Score: 159.8 bits (403), Expect = 2.0e-36 Identity = 80/83 (96.39%), Postives = 80/83 (96.39%), Query Frame = 1
BLAST of Csa3G345360 vs. NCBI nr
Match: gi|802634001|ref|XP_012077783.1| (PREDICTED: polcalcin Che a 3-like [Jatropha curcas]) HSP 1 Score: 107.5 bits (267), Expect = 1.2e-20 Identity = 56/84 (66.67%), Postives = 61/84 (72.62%), Query Frame = 1
BLAST of Csa3G345360 vs. NCBI nr
Match: gi|15228551|ref|NP_186993.1| (putative calcium-binding protein CML28 [Arabidopsis thaliana]) HSP 1 Score: 107.5 bits (267), Expect = 1.2e-20 Identity = 57/84 (67.86%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Csa3G345360 vs. NCBI nr
Match: gi|356553301|ref|XP_003544995.1| (PREDICTED: polcalcin Nic t 1 [Glycine max]) HSP 1 Score: 107.1 bits (266), Expect = 1.6e-20 Identity = 54/84 (64.29%), Postives = 66/84 (78.57%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|