Carg07447 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGACAATGGCGTAGACTCAGCCGAGTGCGAGAGGATTTTCAAGCGATTCGATGCGAACGGCGACGGGCAGATCTCGGCGACGGAGCTCGGCGACGCATTGAACGGAATCGGAGTGAGCTCTGAAGATGCGAAGAGGATGATGGACGCCATTGATAAAGATGGCGACGGCTTCATTTCGTTCCAAGAATTCTTCGAGTTTGCCAAGGATAATCGCGCTTTGATGAAGGATTTTGCCAAAGCCTTTTAG ATGGCAGACAATGGCGTAGACTCAGCCGAGTGCGAGAGGATTTTCAAGCGATTCGATGCGAACGGCGACGGGCAGATCTCGGCGACGGAGCTCGGCGACGCATTGAACGGAATCGGAGTGAGCTCTGAAGATGCGAAGAGGATGATGGACGCCATTGATAAAGATGGCGACGGCTTCATTTCGTTCCAAGAATTCTTCGAGTTTGCCAAGGATAATCGCGCTTTGATGAAGGATTTTGCCAAAGCCTTTTAG ATGGCAGACAATGGCGTAGACTCAGCCGAGTGCGAGAGGATTTTCAAGCGATTCGATGCGAACGGCGACGGGCAGATCTCGGCGACGGAGCTCGGCGACGCATTGAACGGAATCGGAGTGAGCTCTGAAGATGCGAAGAGGATGATGGACGCCATTGATAAAGATGGCGACGGCTTCATTTCGTTCCAAGAATTCTTCGAGTTTGCCAAGGATAATCGCGCTTTGATGAAGGATTTTGCCAAAGCCTTTTAG MADNGVDSAECERIFKRFDANGDGQISATELGDALNGIGVSSEDAKRMMDAIDKDGDGFISFQEFFEFAKDNRALMKDFAKAF
BLAST of Carg07447 vs. NCBI nr
Match: XP_022948513.1 (probable calcium-binding protein CML28 [Cucurbita moschata] >XP_022998721.1 probable calcium-binding protein CML28 [Cucurbita maxima] >XP_023523664.1 probable calcium-binding protein CML28 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.1 bits (266), Expect = 3.0e-20 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Carg07447 vs. NCBI nr
Match: XP_016902062.1 (PREDICTED: polcalcin Bra n 2-like [Cucumis melo]) HSP 1 Score: 88.2 bits (217), Expect = 1.4e-14 Identity = 74/83 (89.16%), Postives = 78/83 (93.98%), Query Frame = 0
BLAST of Carg07447 vs. NCBI nr
Match: XP_004149790.1 (PREDICTED: probable calcium-binding protein CML28 [Cucumis sativus] >KGN57835.1 putative calcium-binding protein CML28 [Cucumis sativus]) HSP 1 Score: 81.6 bits (200), Expect = 1.3e-12 Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Carg07447 vs. NCBI nr
Match: XP_022982739.1 (polcalcin Syr v 3-like [Cucurbita maxima]) HSP 1 Score: 81.6 bits (200), Expect = 1.3e-12 Identity = 68/83 (81.93%), Postives = 74/83 (89.16%), Query Frame = 0
BLAST of Carg07447 vs. NCBI nr
Match: XP_023526616.1 (probable calcium-binding protein CML28 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 81.6 bits (200), Expect = 1.3e-12 Identity = 70/83 (84.34%), Postives = 74/83 (89.16%), Query Frame = 0
BLAST of Carg07447 vs. TAIR10
Match: AT3G03430.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 58.2 bits (139), Expect = 2.9e-09 Identity = 37/84 (44.05%), Postives = 43/84 (51.19%), Query Frame = 0
BLAST of Carg07447 vs. TAIR10
Match: AT5G17480.1 (pollen calcium-binding protein 1) HSP 1 Score: 51.2 bits (121), Expect = 3.5e-07 Identity = 35/84 (41.67%), Postives = 42/84 (50.00%), Query Frame = 0
BLAST of Carg07447 vs. Swiss-Prot
Match: sp|Q8VWY7|POLC2_TOBAC (Polcalcin Nic t 2 OS=Nicotiana tabacum OX=4097 GN=Nict2 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.4e-08 Identity = 37/83 (44.58%), Postives = 44/83 (53.01%), Query Frame = 0
BLAST of Carg07447 vs. Swiss-Prot
Match: sp|Q9SRP7|CML28_ARATH (Probable calcium-binding protein CML28 OS=Arabidopsis thaliana OX=3702 GN=CML28 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.2e-08 Identity = 37/84 (44.05%), Postives = 43/84 (51.19%), Query Frame = 0
BLAST of Carg07447 vs. Swiss-Prot
Match: sp|Q39419|POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula OX=3505 GN=BETV4 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.5e-07 Identity = 35/82 (42.68%), Postives = 42/82 (51.22%), Query Frame = 0
BLAST of Carg07447 vs. Swiss-Prot
Match: sp|O81701|POLC4_ALNGL (Polcalcin Aln g 4 OS=Alnus glutinosa OX=3517 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.6e-07 Identity = 36/82 (43.90%), Postives = 42/82 (51.22%), Query Frame = 0
BLAST of Carg07447 vs. Swiss-Prot
Match: sp|O81092|ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea OX=4146 GN=OLE3 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.4e-07 Identity = 35/84 (41.67%), Postives = 44/84 (52.38%), Query Frame = 0
BLAST of Carg07447 vs. TrEMBL
Match: tr|A0A1S4E1G1|A0A1S4E1G1_CUCME (polcalcin Bra n 2-like OS=Cucumis melo OX=3656 GN=LOC103496835 PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 9.5e-15 Identity = 74/83 (89.16%), Postives = 78/83 (93.98%), Query Frame = 0
BLAST of Carg07447 vs. TrEMBL
Match: tr|A0A0A0L775|A0A0A0L775_CUCSA (Putative calcium-binding protein CML28 OS=Cucumis sativus OX=3659 GN=Csa_3G345360 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 8.9e-13 Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Carg07447 vs. TrEMBL
Match: tr|A0A164UEU9|A0A164UEU9_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_025870 PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.9e-07 Identity = 54/78 (69.23%), Postives = 59/78 (75.64%), Query Frame = 0
BLAST of Carg07447 vs. TrEMBL
Match: tr|A0A2N9EPY6|A0A2N9EPY6_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS4757 PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 9.5e-07 Identity = 39/84 (46.43%), Postives = 43/84 (51.19%), Query Frame = 0
BLAST of Carg07447 vs. TrEMBL
Match: tr|A0A068U540|A0A068U540_COFCA (Uncharacterized protein OS=Coffea canephora OX=49390 GN=GSCOC_T00040170001 PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 9.5e-07 Identity = 38/84 (45.24%), Postives = 43/84 (51.19%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|