ClCG05G010960 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGCCTTCCGCCGCCATTTTACTCTCTCTTCCTTTCTTCATCCTGTTGGTCCACGCCCAAACCTCCTCTCCACAAAATCCCGACGCTGAAATAAAATGTGGATCATGCCCTTGTTCCAACCCATGTGTTCAACAACTACCGCCGCCGCCACCTCCTCCTCCTTGTACCCCAACTCTGCCGTCTCGACCACCGCCTCCTAGGTTTATTTATACATCATCGTCGTCTCCACCACCACCTCCAAGGTTTATTTATACTACCGGCATTCCCGGTGACCTCTACCAGGTCGATGCGAATAATCATTGGTATTACTTCTCCGGCACGACGGGGAAGCGGCCGGCCATGGCAGCGGTTGTGGTGGCGCTTGGCTGTGGAACTTTGCATCTCATGGGGTTTGGTAAGTGGTGA ATGGCGCCTTCCGCCGCCATTTTACTCTCTCTTCCTTTCTTCATCCTGTTGGTCCACGCCCAAACCTCCTCTCCACAAAATCCCGACGCTGAAATAAAATGTGGATCATGCCCTTGTTCCAACCCATGTGTTCAACAACTACCGCCGCCGCCACCTCCTCCTCCTTGTACCCCAACTCTGCCGTCTCGACCACCGCCTCCTAGGTTTATTTATACATCATCGTCGTCTCCACCACCACCTCCAAGGTTTATTTATACTACCGGCATTCCCGGTGACCTCTACCAGGTCGATGCGAATAATCATTGGTATTACTTCTCCGGCACGACGGGGAAGCGGCCGGCCATGGCAGCGGTTGTGGTGGCGCTTGGCTGTGGAACTTTGCATCTCATGGGGTTTGGTAAGTGGTGA ATGGCGCCTTCCGCCGCCATTTTACTCTCTCTTCCTTTCTTCATCCTGTTGGTCCACGCCCAAACCTCCTCTCCACAAAATCCCGACGCTGAAATAAAATGTGGATCATGCCCTTGTTCCAACCCATGTGTTCAACAACTACCGCCGCCGCCACCTCCTCCTCCTTGTACCCCAACTCTGCCGTCTCGACCACCGCCTCCTAGGTTTATTTATACATCATCGTCGTCTCCACCACCACCTCCAAGGTTTATTTATACTACCGGCATTCCCGGTGACCTCTACCAGGTCGATGCGAATAATCATTGGTATTACTTCTCCGGCACGACGGGGAAGCGGCCGGCCATGGCAGCGGTTGTGGTGGCGCTTGGCTGTGGAACTTTGCATCTCATGGGGTTTGGTAAGTGGTGA MAPSAAILLSLPFFILLVHAQTSSPQNPDAEIKCGSCPCSNPCVQQLPPPPPPPPCTPTLPSRPPPPRFIYTSSSSPPPPPRFIYTTGIPGDLYQVDANNHWYYFSGTTGKRPAMAAVVVALGCGTLHLMGFGKW
BLAST of ClCG05G010960 vs. Swiss-Prot
Match: PRR12_MOUSE (Proline-rich protein 12 OS=Mus musculus GN=Prr12 PE=1 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 9.2e-07 Identity = 28/60 (46.67%), Postives = 30/60 (50.00%), Query Frame = 1
HSP 2 Score: 47.4 bits (111), Expect = 1.5e-04 Identity = 23/56 (41.07%), Postives = 22/56 (39.29%), Query Frame = 1
BLAST of ClCG05G010960 vs. Swiss-Prot
Match: FH20_ARATH (Formin-like protein 20 OS=Arabidopsis thaliana GN=FH20 PE=2 SV=3) HSP 1 Score: 52.0 bits (123), Expect = 6.0e-06 Identity = 21/34 (61.76%), Postives = 21/34 (61.76%), Query Frame = 1
HSP 2 Score: 49.7 bits (117), Expect = 3.0e-05 Identity = 27/61 (44.26%), Postives = 27/61 (44.26%), Query Frame = 1
HSP 3 Score: 43.1 bits (100), Expect = 2.8e-03 Identity = 22/47 (46.81%), Postives = 21/47 (44.68%), Query Frame = 1
HSP 4 Score: 42.7 bits (99), Expect = 3.6e-03 Identity = 29/82 (35.37%), Postives = 33/82 (40.24%), Query Frame = 1
HSP 5 Score: 41.6 bits (96), Expect = 8.1e-03 Identity = 24/59 (40.68%), Postives = 26/59 (44.07%), Query Frame = 1
HSP 6 Score: 32.3 bits (72), Expect = 4.9e+00 Identity = 16/36 (44.44%), Postives = 16/36 (44.44%), Query Frame = 1
BLAST of ClCG05G010960 vs. Swiss-Prot
Match: G3PT_MOUSE (Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Mus musculus GN=Gapdhs PE=1 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 6.0e-06 Identity = 25/64 (39.06%), Postives = 28/64 (43.75%), Query Frame = 1
BLAST of ClCG05G010960 vs. Swiss-Prot
Match: PRR12_HUMAN (Proline-rich protein 12 OS=Homo sapiens GN=PRR12 PE=1 SV=2) HSP 1 Score: 51.6 bits (122), Expect = 7.8e-06 Identity = 33/81 (40.74%), Postives = 38/81 (46.91%), Query Frame = 1
HSP 2 Score: 43.1 bits (100), Expect = 2.8e-03 Identity = 19/44 (43.18%), Postives = 20/44 (45.45%), Query Frame = 1
HSP 3 Score: 31.2 bits (69), Expect = 1.1e+01 Identity = 12/20 (60.00%), Postives = 10/20 (50.00%), Query Frame = 1
BLAST of ClCG05G010960 vs. TrEMBL
Match: A0A0A0L7R0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G346900 PE=4 SV=1) HSP 1 Score: 224.9 bits (572), Expect = 5.7e-56 Identity = 106/150 (70.67%), Postives = 117/150 (78.00%), Query Frame = 1
BLAST of ClCG05G010960 vs. TrEMBL
Match: A0A068TX13_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00032833001 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 8.9e-17 Identity = 48/102 (47.06%), Postives = 56/102 (54.90%), Query Frame = 1
BLAST of ClCG05G010960 vs. TrEMBL
Match: A0A139A4D5_GONPR (Uncharacterized protein OS=Gonapodya prolifera JEL478 GN=M427DRAFT_72798 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 7.1e-06 Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = 1
BLAST of ClCG05G010960 vs. TrEMBL
Match: A0A139A4D5_GONPR (Uncharacterized protein OS=Gonapodya prolifera JEL478 GN=M427DRAFT_72798 PE=4 SV=1) HSP 1 Score: 41.6 bits (96), Expect = 9.0e-01 Identity = 22/46 (47.83%), Postives = 23/46 (50.00%), Query Frame = 1
HSP 2 Score: 58.2 bits (139), Expect = 9.3e-06 Identity = 31/70 (44.29%), Postives = 36/70 (51.43%), Query Frame = 1
BLAST of ClCG05G010960 vs. TrEMBL
Match: A0A0R1EGJ2_DROYA (Uncharacterized protein OS=Drosophila yakuba GN=Dyak\GE16158 PE=4 SV=1) HSP 1 Score: 42.7 bits (99), Expect = 4.0e-01 Identity = 21/44 (47.73%), Postives = 27/44 (61.36%), Query Frame = 1
HSP 2 Score: 42.0 bits (97), Expect = 6.9e-01 Identity = 24/61 (39.34%), Postives = 29/61 (47.54%), Query Frame = 1
BLAST of ClCG05G010960 vs. TAIR10
Match: AT1G23040.1 (AT1G23040.1 hydroxyproline-rich glycoprotein family protein) HSP 1 Score: 72.4 bits (176), Expect = 2.4e-13 Identity = 37/88 (42.05%), Postives = 45/88 (51.14%), Query Frame = 1
BLAST of ClCG05G010960 vs. TAIR10
Match: AT3G03350.2 (AT3G03350.2 NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 68.9 bits (167), Expect = 2.7e-12 Identity = 31/71 (43.66%), Postives = 42/71 (59.15%), Query Frame = 1
BLAST of ClCG05G010960 vs. TAIR10
Match: AT1G70990.1 (AT1G70990.1 proline-rich family protein) HSP 1 Score: 67.0 bits (162), Expect = 1.0e-11 Identity = 40/103 (38.83%), Postives = 52/103 (50.49%), Query Frame = 1
BLAST of ClCG05G010960 vs. TAIR10
Match: AT1G02405.1 (AT1G02405.1 proline-rich family protein) HSP 1 Score: 60.8 bits (146), Expect = 7.2e-10 Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 1
BLAST of ClCG05G010960 vs. TAIR10
Match: AT4G08370.1 (AT4G08370.1 Proline-rich extensin-like family protein) HSP 1 Score: 53.9 bits (128), Expect = 8.8e-08 Identity = 36/112 (32.14%), Postives = 48/112 (42.86%), Query Frame = 1
BLAST of ClCG05G010960 vs. NCBI nr
Match: gi|778680858|ref|XP_011651408.1| (PREDICTED: leucine-rich repeat extensin-like protein 3 [Cucumis sativus]) HSP 1 Score: 224.9 bits (572), Expect = 8.2e-56 Identity = 106/150 (70.67%), Postives = 117/150 (78.00%), Query Frame = 1
BLAST of ClCG05G010960 vs. NCBI nr
Match: gi|590652126|ref|XP_007033069.1| (Uncharacterized protein TCM_019232 [Theobroma cacao]) HSP 1 Score: 116.7 bits (291), Expect = 3.1e-23 Identity = 61/134 (45.52%), Postives = 79/134 (58.96%), Query Frame = 1
BLAST of ClCG05G010960 vs. NCBI nr
Match: gi|255584475|ref|XP_002532967.1| (PREDICTED: formin-like protein 3 [Ricinus communis]) HSP 1 Score: 112.8 bits (281), Expect = 4.5e-22 Identity = 57/108 (52.78%), Postives = 68/108 (62.96%), Query Frame = 1
BLAST of ClCG05G010960 vs. NCBI nr
Match: gi|566211035|ref|XP_006372591.1| (hypothetical protein POPTR_0017s03030g [Populus trichocarpa]) HSP 1 Score: 112.5 bits (280), Expect = 5.9e-22 Identity = 53/119 (44.54%), Postives = 68/119 (57.14%), Query Frame = 1
BLAST of ClCG05G010960 vs. NCBI nr
Match: gi|697159392|ref|XP_009588454.1| (PREDICTED: leucine-rich repeat extensin-like protein 1 [Nicotiana tomentosiformis]) HSP 1 Score: 106.7 bits (265), Expect = 3.3e-20 Identity = 56/129 (43.41%), Postives = 65/129 (50.39%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|