CmaCh04G024300 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGAAAGAAAACACCTTCAACTCCATGGCCACCGCCCCTCCGCCCTCAAAATCTCCAAACACTCCCACAATATCAAAAAGCTGCCGCAGCTCCCCCCACCACCACCGCACCACCGCCCTGTCATAATCTACACCGACTCCCCCAAGATAATCCACACCAATCCTACCCAATTCAAGGAATTGGTCCAACGTCTCACTAGCTGCCAATCTAATAGTCCTGATACTCATCCGGTCCAATCCAAGACAATATCAATATCTATGTCGATGCAAACGAGTAGTACCGAACAAGGAATGGAGAGTGTAGGTCGTTTCCCAACCGGGATATTACCGCCGATGCCGGAGTTTCTACTGCCCGTCATGCCGACGCAGCCGTCGGCGTCAACTGATCTCAGCTCTCTCACCCACTACTTCCAAGACAGCTCCATAGCTCCTAATAATTTTGCATCGTCGCTAGATTTCTTCGACAACTTCCCTGATTTTCATTAA ATGGCTGAAAGAAAACACCTTCAACTCCATGGCCACCGCCCCTCCGCCCTCAAAATCTCCAAACACTCCCACAATATCAAAAAGCTGCCGCAGCTCCCCCCACCACCACCGCACCACCGCCCTGTCATAATCTACACCGACTCCCCCAAGATAATCCACACCAATCCTACCCAATTCAAGGAATTGGTCCAACGTCTCACTAGCTGCCAATCTAATAGTCCTGATACTCATCCGGTCCAATCCAAGACAATATCAATATCTATGTCGATGCAAACGAGTAGTACCGAACAAGGAATGGAGAGTGTAGGTCGTTTCCCAACCGGGATATTACCGCCGATGCCGGAGTTTCTACTGCCCGTCATGCCGACGCAGCCGTCGGCGTCAACTGATCTCAGCTCTCTCACCCACTACTTCCAAGACAGCTCCATAGCTCCTAATAATTTTGCATCGTCGCTAGATTTCTTCGACAACTTCCCTGATTTTCATTAA ATGGCTGAAAGAAAACACCTTCAACTCCATGGCCACCGCCCCTCCGCCCTCAAAATCTCCAAACACTCCCACAATATCAAAAAGCTGCCGCAGCTCCCCCCACCACCACCGCACCACCGCCCTGTCATAATCTACACCGACTCCCCCAAGATAATCCACACCAATCCTACCCAATTCAAGGAATTGGTCCAACGTCTCACTAGCTGCCAATCTAATAGTCCTGATACTCATCCGGTCCAATCCAAGACAATATCAATATCTATGTCGATGCAAACGAGTAGTACCGAACAAGGAATGGAGAGTGTAGGTCGTTTCCCAACCGGGATATTACCGCCGATGCCGGAGTTTCTACTGCCCGTCATGCCGACGCAGCCGTCGGCGTCAACTGATCTCAGCTCTCTCACCCACTACTTCCAAGACAGCTCCATAGCTCCTAATAATTTTGCATCGTCGCTAGATTTCTTCGACAACTTCCCTGATTTTCATTAA MAERKHLQLHGHRPSALKISKHSHNIKKLPQLPPPPPHHRPVIIYTDSPKIIHTNPTQFKELVQRLTSCQSNSPDTHPVQSKTISISMSMQTSSTEQGMESVGRFPTGILPPMPEFLLPVMPTQPSASTDLSSLTHYFQDSSIAPNNFASSLDFFDNFPDFH
BLAST of CmaCh04G024300 vs. Swiss-Prot
Match: MKS1_ARATH (Protein MKS1 OS=Arabidopsis thaliana GN=MKS1 PE=1 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 5.3e-09 Identity = 52/172 (30.23%), Postives = 77/172 (44.77%), Query Frame = 1
BLAST of CmaCh04G024300 vs. Swiss-Prot
Match: VQ8_ARATH (VQ motif-containing protein 8, chloroplastic OS=Arabidopsis thaliana GN=VQ8 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 2.9e-07 Identity = 33/63 (52.38%), Postives = 40/63 (63.49%), Query Frame = 1
BLAST of CmaCh04G024300 vs. Swiss-Prot
Match: VQ20_ARATH (VQ motif-containing protein 20 OS=Arabidopsis thaliana GN=VQ20 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 4.2e-06 Identity = 41/105 (39.05%), Postives = 52/105 (49.52%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TrEMBL
Match: A0A0A0KI80_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G338080 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 1.1e-26 Identity = 95/182 (52.20%), Postives = 112/182 (61.54%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TrEMBL
Match: M5VJC3_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa026048mg PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 6.9e-16 Identity = 78/208 (37.50%), Postives = 104/208 (50.00%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TrEMBL
Match: A0A0B2PJC9_GLYSO (Protein MKS1 OS=Glycine soja GN=glysoja_040860 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 3.9e-11 Identity = 68/187 (36.36%), Postives = 89/187 (47.59%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TrEMBL
Match: V7AY52_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_009G136500g PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 5.1e-11 Identity = 48/117 (41.03%), Postives = 65/117 (55.56%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TrEMBL
Match: K7KUQ0_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_06G124400 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 8.8e-11 Identity = 41/75 (54.67%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TAIR10
Match: AT3G18690.1 (AT3G18690.1 MAP kinase substrate 1) HSP 1 Score: 62.4 bits (150), Expect = 3.0e-10 Identity = 52/172 (30.23%), Postives = 77/172 (44.77%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TAIR10
Match: AT1G68450.1 (AT1G68450.1 VQ motif-containing protein) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-08 Identity = 33/63 (52.38%), Postives = 40/63 (63.49%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TAIR10
Match: AT1G21326.1 (AT1G21326.1 VQ motif-containing protein) HSP 1 Score: 54.7 bits (130), Expect = 6.2e-08 Identity = 41/108 (37.96%), Postives = 49/108 (45.37%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TAIR10
Match: AT3G18360.1 (AT3G18360.1 VQ motif-containing protein) HSP 1 Score: 52.8 bits (125), Expect = 2.4e-07 Identity = 41/105 (39.05%), Postives = 52/105 (49.52%), Query Frame = 1
BLAST of CmaCh04G024300 vs. TAIR10
Match: AT1G21320.1 (AT1G21320.1 nucleotide binding;nucleic acid binding) HSP 1 Score: 50.1 bits (118), Expect = 1.5e-06 Identity = 38/108 (35.19%), Postives = 48/108 (44.44%), Query Frame = 1
BLAST of CmaCh04G024300 vs. NCBI nr
Match: gi|449462192|ref|XP_004148825.1| (PREDICTED: protein MKS1-like [Cucumis sativus]) HSP 1 Score: 127.9 bits (320), Expect = 1.6e-26 Identity = 95/182 (52.20%), Postives = 112/182 (61.54%), Query Frame = 1
BLAST of CmaCh04G024300 vs. NCBI nr
Match: gi|659082070|ref|XP_008441652.1| (PREDICTED: protein MKS1-like, partial [Cucumis melo]) HSP 1 Score: 120.9 bits (302), Expect = 2.0e-24 Identity = 89/178 (50.00%), Postives = 107/178 (60.11%), Query Frame = 1
BLAST of CmaCh04G024300 vs. NCBI nr
Match: gi|645264333|ref|XP_008237628.1| (PREDICTED: protein MKS1 [Prunus mume]) HSP 1 Score: 94.0 bits (232), Expect = 2.6e-16 Identity = 79/208 (37.98%), Postives = 104/208 (50.00%), Query Frame = 1
BLAST of CmaCh04G024300 vs. NCBI nr
Match: gi|595792449|ref|XP_007199973.1| (hypothetical protein PRUPE_ppa026048mg [Prunus persica]) HSP 1 Score: 92.0 bits (227), Expect = 1.0e-15 Identity = 78/208 (37.50%), Postives = 104/208 (50.00%), Query Frame = 1
BLAST of CmaCh04G024300 vs. NCBI nr
Match: gi|470108489|ref|XP_004290549.1| (PREDICTED: protein MKS1 [Fragaria vesca subsp. vesca]) HSP 1 Score: 86.3 bits (212), Expect = 5.5e-14 Identity = 80/206 (38.83%), Postives = 98/206 (47.57%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|