Carg01590 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCTTCTCTTTGTTCTTCAACACCTAATGCCATGGCTGAAAGAAAAGAGCTTCAACTCCAAGGTCCCCGTCCCGCTGCCCTCAAGATCACCAAAGACTCCCACAAGATCGGCAAGCCGCCGCACCGGCCCGTCATCATCTACACCGTCTCCCCCAAGGTCATCCACACCGACCCTACTCAATTCAAGGACTTGGTCCAGCGTCTCACTGGCCACAAACCCTCCTCCCATGACTCTCACCATCCACCCAATACGACGATGATTATGAGTACCAATCATCAAGGAGCAGAGAGGGTAGGTCACGGAATATTATCGCCAACGCCAGGGTTGCTGCCGCCGATTCCAGCGAATATTTTCACTCCGACGCCGCCGCAGTCAGCTGAGCTCAGCCCTCTTACCCACTTTTTTCGGGATCTTAGCCCCATAGCTCCAAATCGATTCTCGTCGTCGCTAGATTTCTTCCAAAACTTCCCTGATTTGCATAATTAA ATGTCTTCTTCTCTTTGTTCTTCAACACCTAATGCCATGGCTGAAAGAAAAGAGCTTCAACTCCAAGGTCCCCGTCCCGCTGCCCTCAAGATCACCAAAGACTCCCACAAGATCGGCAAGCCGCCGCACCGGCCCGTCATCATCTACACCGTCTCCCCCAAGGTCATCCACACCGACCCTACTCAATTCAAGGACTTGGTCCAGCGTCTCACTGGCCACAAACCCTCCTCCCATGACTCTCACCATCCACCCAATACGACGATGATTATGAGTACCAATCATCAAGGAGCAGAGAGGGTAGGTCACGGAATATTATCGCCAACGCCAGGGTTGCTGCCGCCGATTCCAGCGAATATTTTCACTCCGACGCCGCCGCAGTCAGCTGAGCTCAGCCCTCTTACCCACTTTTTTCGGGATCTTAGCCCCATAGCTCCAAATCGATTCTCGTCGTCGCTAGATTTCTTCCAAAACTTCCCTGATTTGCATAATTAA ATGTCTTCTTCTCTTTGTTCTTCAACACCTAATGCCATGGCTGAAAGAAAAGAGCTTCAACTCCAAGGTCCCCGTCCCGCTGCCCTCAAGATCACCAAAGACTCCCACAAGATCGGCAAGCCGCCGCACCGGCCCGTCATCATCTACACCGTCTCCCCCAAGGTCATCCACACCGACCCTACTCAATTCAAGGACTTGGTCCAGCGTCTCACTGGCCACAAACCCTCCTCCCATGACTCTCACCATCCACCCAATACGACGATGATTATGAGTACCAATCATCAAGGAGCAGAGAGGGTAGGTCACGGAATATTATCGCCAACGCCAGGGTTGCTGCCGCCGATTCCAGCGAATATTTTCACTCCGACGCCGCCGCAGTCAGCTGAGCTCAGCCCTCTTACCCACTTTTTTCGGGATCTTAGCCCCATAGCTCCAAATCGATTCTCGTCGTCGCTAGATTTCTTCCAAAACTTCCCTGATTTGCATAATTAA MSSSLCSSTPNAMAERKELQLQGPRPAALKITKDSHKIGKPPHRPVIIYTVSPKVIHTDPTQFKDLVQRLTGHKPSSHDSHHPPNTTMIMSTNHQGAERVGHGILSPTPGLLPPIPANIFTPTPPQSAELSPLTHFFRDLSPIAPNRFSSSLDFFQNFPDLHN
BLAST of Carg01590 vs. NCBI nr
Match: XP_022939148.1 (protein MKS1-like [Cucurbita moschata]) HSP 1 Score: 306.2 bits (783), Expect = 6.6e-80 Identity = 148/150 (98.67%), Postives = 148/150 (98.67%), Query Frame = 0
BLAST of Carg01590 vs. NCBI nr
Match: XP_023551504.1 (protein MKS1-like [Cucurbita pepo subsp. pepo] >XP_023551505.1 protein MKS1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 304.3 bits (778), Expect = 2.5e-79 Identity = 147/150 (98.00%), Postives = 148/150 (98.67%), Query Frame = 0
BLAST of Carg01590 vs. NCBI nr
Match: XP_022993351.1 (protein MKS1-like [Cucurbita maxima]) HSP 1 Score: 299.3 bits (765), Expect = 8.0e-78 Identity = 145/150 (96.67%), Postives = 147/150 (98.00%), Query Frame = 0
BLAST of Carg01590 vs. NCBI nr
Match: XP_008441652.2 (PREDICTED: protein MKS1-like [Cucumis melo]) HSP 1 Score: 181.4 bits (459), Expect = 2.4e-42 Identity = 106/174 (60.92%), Postives = 120/174 (68.97%), Query Frame = 0
BLAST of Carg01590 vs. NCBI nr
Match: XP_004148825.1 (PREDICTED: protein MKS1-like [Cucumis sativus] >KGN47476.1 hypothetical protein Csa_6G338080 [Cucumis sativus]) HSP 1 Score: 177.2 bits (448), Expect = 4.6e-41 Identity = 106/178 (59.55%), Postives = 117/178 (65.73%), Query Frame = 0
BLAST of Carg01590 vs. TAIR10
Match: AT3G18690.1 (MAP kinase substrate 1) HSP 1 Score: 74.7 bits (182), Expect = 5.8e-14 Identity = 56/169 (33.14%), Postives = 76/169 (44.97%), Query Frame = 0
BLAST of Carg01590 vs. TAIR10
Match: AT1G21326.1 (VQ motif-containing protein) HSP 1 Score: 59.7 bits (143), Expect = 1.9e-09 Identity = 67/231 (29.00%), Postives = 84/231 (36.36%), Query Frame = 0
BLAST of Carg01590 vs. TAIR10
Match: AT3G18360.1 (VQ motif-containing protein) HSP 1 Score: 55.5 bits (132), Expect = 3.7e-08 Identity = 30/62 (48.39%), Postives = 36/62 (58.06%), Query Frame = 0
BLAST of Carg01590 vs. TAIR10
Match: AT1G21320.1 (nucleotide binding;nucleic acid binding) HSP 1 Score: 55.1 bits (131), Expect = 4.8e-08 Identity = 33/75 (44.00%), Postives = 38/75 (50.67%), Query Frame = 0
BLAST of Carg01590 vs. TAIR10
Match: AT1G68450.1 (VQ motif-containing protein) HSP 1 Score: 51.6 bits (122), Expect = 5.3e-07 Identity = 31/64 (48.44%), Postives = 37/64 (57.81%), Query Frame = 0
BLAST of Carg01590 vs. Swiss-Prot
Match: sp|Q8LGD5|MKS1_ARATH (Protein MKS1 OS=Arabidopsis thaliana OX=3702 GN=MKS1 PE=1 SV=2) HSP 1 Score: 74.7 bits (182), Expect = 1.1e-12 Identity = 56/169 (33.14%), Postives = 76/169 (44.97%), Query Frame = 0
BLAST of Carg01590 vs. Swiss-Prot
Match: sp|Q9LS54|VQ20_ARATH (VQ motif-containing protein 20 OS=Arabidopsis thaliana OX=3702 GN=VQ20 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 6.6e-07 Identity = 30/62 (48.39%), Postives = 36/62 (58.06%), Query Frame = 0
BLAST of Carg01590 vs. Swiss-Prot
Match: sp|F4HWF9|NSRB_ARATH (Nuclear speckle RNA-binding protein B OS=Arabidopsis thaliana OX=3702 GN=NSRB PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 8.6e-07 Identity = 33/75 (44.00%), Postives = 38/75 (50.67%), Query Frame = 0
BLAST of Carg01590 vs. Swiss-Prot
Match: sp|Q9CA36|VQ8_ARATH (VQ motif-containing protein 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VQ8 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 9.5e-06 Identity = 31/64 (48.44%), Postives = 37/64 (57.81%), Query Frame = 0
BLAST of Carg01590 vs. TrEMBL
Match: tr|A0A1S3B4N1|A0A1S3B4N1_CUCME (protein MKS1-like OS=Cucumis melo OX=3656 GN=LOC103485735 PE=4 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 1.6e-42 Identity = 106/174 (60.92%), Postives = 120/174 (68.97%), Query Frame = 0
BLAST of Carg01590 vs. TrEMBL
Match: tr|A0A0A0KI80|A0A0A0KI80_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G338080 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 3.0e-41 Identity = 106/178 (59.55%), Postives = 117/178 (65.73%), Query Frame = 0
BLAST of Carg01590 vs. TrEMBL
Match: tr|A0A2I0W3R9|A0A2I0W3R9_9ASPA (Protein MKS1 OS=Dendrobium catenatum OX=906689 GN=MKS1 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 2.5e-19 Identity = 65/141 (46.10%), Postives = 84/141 (59.57%), Query Frame = 0
BLAST of Carg01590 vs. TrEMBL
Match: tr|A0A2N9E868|A0A2N9E868_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS3058 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.6e-18 Identity = 75/191 (39.27%), Postives = 94/191 (49.21%), Query Frame = 0
BLAST of Carg01590 vs. TrEMBL
Match: tr|A0A151R6L2|A0A151R6L2_CAJCA (Protein MKS1 OS=Cajanus cajan OX=3821 GN=KK1_040566 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.8e-17 Identity = 74/188 (39.36%), Postives = 87/188 (46.28%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|