Carg13204 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCAGCACCACCGCACTCACCGCCCCAATTCCGGTCACCTCCTTCCTCCGGCGGCAGCAGCCGGTGACCGGGGTAAGCCTGAGGCCATTTCCCAACGTGGGTCAGTCTCTGTTTGGGCTGAAACTCGGCAGCAGCCGCGGTGGAAGCATGACAGTGATGGCATACAAGGTGAAGCTGATTACACCAGAGGGAGAGAAAGAGATTGAATGCAGCGGCGATGATTACATTCTTGATGCGGCGGAGGAAAGCGGCGTTGATCTGCCGTACTCTTGCAGAGCAGGGGCGTGTTCTTCGTGCATTGGGAAGCTGAAATCAGGGAAGGTGGATCAATCTGATAACAGCTTTCTTGATGATCAACAAATGGAAGATGGGTGGGTTCTGACTTGTGTTGCAAGGCCTGAATCTGATATTGTAATTGAGACCCACAAGGAGGAGGTCTTTGCTGATTCTGCCTAA ATGGGCAGCACCACCGCACTCACCGCCCCAATTCCGGTCACCTCCTTCCTCCGGCGGCAGCAGCCGGTGACCGGGGTAAGCCTGAGGCCATTTCCCAACGTGGGTCAGTCTCTGTTTGGGCTGAAACTCGGCAGCAGCCGCGGTGGAAGCATGACAGTGATGGCATACAAGGTGAAGCTGATTACACCAGAGGGAGAGAAAGAGATTGAATGCAGCGGCGATGATTACATTCTTGATGCGGCGGAGGAAAGCGGCGTTGATCTGCCGTACTCTTGCAGAGCAGGGGCGTGTTCTTCGTGCATTGGGAAGCTGAAATCAGGGAAGGTGGATCAATCTGATAACAGCTTTCTTGATGATCAACAAATGGAAGATGGGTGGGTTCTGACTTGTGTTGCAAGGCCTGAATCTGATATTGTAATTGAGACCCACAAGGAGGAGGTCTTTGCTGATTCTGCCTAA ATGGGCAGCACCACCGCACTCACCGCCCCAATTCCGGTCACCTCCTTCCTCCGGCGGCAGCAGCCGGTGACCGGGGTAAGCCTGAGGCCATTTCCCAACGTGGGTCAGTCTCTGTTTGGGCTGAAACTCGGCAGCAGCCGCGGTGGAAGCATGACAGTGATGGCATACAAGGTGAAGCTGATTACACCAGAGGGAGAGAAAGAGATTGAATGCAGCGGCGATGATTACATTCTTGATGCGGCGGAGGAAAGCGGCGTTGATCTGCCGTACTCTTGCAGAGCAGGGGCGTGTTCTTCGTGCATTGGGAAGCTGAAATCAGGGAAGGTGGATCAATCTGATAACAGCTTTCTTGATGATCAACAAATGGAAGATGGGTGGGTTCTGACTTGTGTTGCAAGGCCTGAATCTGATATTGTAATTGAGACCCACAAGGAGGAGGTCTTTGCTGATTCTGCCTAA MGSTTALTAPIPVTSFLRRQQPVTGVSLRPFPNVGQSLFGLKLGSSRGGSMTVMAYKVKLITPEGEKEIECSGDDYILDAAEESGVDLPYSCRAGACSSCIGKLKSGKVDQSDNSFLDDQQMEDGWVLTCVARPESDIVIETHKEEVFADSA
BLAST of Carg13204 vs. NCBI nr
Match: XP_022941964.1 (ferredoxin-like [Cucurbita moschata] >XP_022983176.1 ferredoxin-like [Cucurbita maxima] >XP_023547581.1 ferredoxin-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 306.2 bits (783), Expect = 6.1e-80 Identity = 152/152 (100.00%), Postives = 152/152 (100.00%), Query Frame = 0
BLAST of Carg13204 vs. NCBI nr
Match: XP_008456052.1 (PREDICTED: ferredoxin-like [Cucumis melo]) HSP 1 Score: 226.5 bits (576), Expect = 6.2e-56 Identity = 112/149 (75.17%), Postives = 125/149 (83.89%), Query Frame = 0
BLAST of Carg13204 vs. NCBI nr
Match: XP_004146259.1 (PREDICTED: ferredoxin, leaf L-A-like [Cucumis sativus] >KGN57598.1 hypothetical protein Csa_3G222800 [Cucumis sativus]) HSP 1 Score: 221.5 bits (563), Expect = 2.0e-54 Identity = 106/149 (71.14%), Postives = 126/149 (84.56%), Query Frame = 0
BLAST of Carg13204 vs. NCBI nr
Match: XP_022136604.1 (ferredoxin-like [Momordica charantia]) HSP 1 Score: 218.0 bits (554), Expect = 2.2e-53 Identity = 109/149 (73.15%), Postives = 122/149 (81.88%), Query Frame = 0
BLAST of Carg13204 vs. NCBI nr
Match: XP_012071291.1 (ferredoxin-A [Jatropha curcas] >KDP38815.1 hypothetical protein JCGZ_04972 [Jatropha curcas]) HSP 1 Score: 198.0 bits (502), Expect = 2.4e-47 Identity = 105/145 (72.41%), Postives = 119/145 (82.07%), Query Frame = 0
BLAST of Carg13204 vs. TAIR10
Match: AT1G10960.1 (ferredoxin 1) HSP 1 Score: 192.2 bits (487), Expect = 2.3e-49 Identity = 100/147 (68.03%), Postives = 120/147 (81.63%), Query Frame = 0
BLAST of Carg13204 vs. TAIR10
Match: AT1G60950.1 (2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 182.2 bits (461), Expect = 2.4e-46 Identity = 93/146 (63.70%), Postives = 114/146 (78.08%), Query Frame = 0
BLAST of Carg13204 vs. TAIR10
Match: AT2G27510.1 (ferredoxin 3) HSP 1 Score: 142.5 bits (358), Expect = 2.1e-34 Identity = 69/108 (63.89%), Postives = 82/108 (75.93%), Query Frame = 0
BLAST of Carg13204 vs. TAIR10
Match: AT5G10000.1 (ferredoxin 4) HSP 1 Score: 114.0 bits (284), Expect = 8.1e-26 Identity = 59/107 (55.14%), Postives = 79/107 (73.83%), Query Frame = 0
BLAST of Carg13204 vs. TAIR10
Match: AT4G14890.1 (2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 71.2 bits (173), Expect = 6.0e-13 Identity = 49/141 (34.75%), Postives = 66/141 (46.81%), Query Frame = 0
BLAST of Carg13204 vs. Swiss-Prot
Match: sp|O04090|FER1_ARATH (Ferredoxin-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FD1 PE=1 SV=1) HSP 1 Score: 192.2 bits (487), Expect = 4.2e-48 Identity = 100/147 (68.03%), Postives = 120/147 (81.63%), Query Frame = 0
BLAST of Carg13204 vs. Swiss-Prot
Match: sp|P16972|FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FD2 PE=1 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 4.4e-45 Identity = 93/146 (63.70%), Postives = 114/146 (78.08%), Query Frame = 0
BLAST of Carg13204 vs. Swiss-Prot
Match: sp|Q9ZTS2|FER_CAPAN (Ferredoxin, chloroplastic OS=Capsicum annuum OX=4072 GN=AP1 PE=1 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 1.6e-42 Identity = 87/141 (61.70%), Postives = 110/141 (78.01%), Query Frame = 0
BLAST of Carg13204 vs. Swiss-Prot
Match: sp|O04683|FER1_MESCR (Ferredoxin-1, chloroplastic OS=Mesembryanthemum crystallinum OX=3544 PE=2 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 1.7e-41 Identity = 83/144 (57.64%), Postives = 105/144 (72.92%), Query Frame = 0
BLAST of Carg13204 vs. Swiss-Prot
Match: sp|P00221|FER1_SPIOL (Ferredoxin-1, chloroplastic OS=Spinacia oleracea OX=3562 GN=PETF PE=1 SV=2) HSP 1 Score: 167.5 bits (423), Expect = 1.1e-40 Identity = 84/144 (58.33%), Postives = 103/144 (71.53%), Query Frame = 0
BLAST of Carg13204 vs. TrEMBL
Match: tr|A0A1S3C1X0|A0A1S3C1X0_CUCME (Ferredoxin OS=Cucumis melo OX=3656 GN=LOC103496100 PE=3 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 4.1e-56 Identity = 112/149 (75.17%), Postives = 125/149 (83.89%), Query Frame = 0
BLAST of Carg13204 vs. TrEMBL
Match: tr|A0A0A0L764|A0A0A0L764_CUCSA (Ferredoxin OS=Cucumis sativus OX=3659 GN=Csa_3G222800 PE=3 SV=1) HSP 1 Score: 221.5 bits (563), Expect = 1.3e-54 Identity = 106/149 (71.14%), Postives = 126/149 (84.56%), Query Frame = 0
BLAST of Carg13204 vs. TrEMBL
Match: tr|A0A067L2U1|A0A067L2U1_JATCU (Ferredoxin OS=Jatropha curcas OX=180498 GN=JCGZ_04972 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 1.6e-47 Identity = 105/145 (72.41%), Postives = 119/145 (82.07%), Query Frame = 0
BLAST of Carg13204 vs. TrEMBL
Match: tr|F8SPG7|F8SPG7_CAMSI (Ferredoxin OS=Camellia sinensis OX=4442 PE=2 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 4.5e-47 Identity = 101/147 (68.71%), Postives = 116/147 (78.91%), Query Frame = 0
BLAST of Carg13204 vs. TrEMBL
Match: tr|A0A2P5BC06|A0A2P5BC06_PARAD (Ferredoxin OS=Parasponia andersonii OX=3476 GN=PanWU01x14_252590 PE=3 SV=1) HSP 1 Score: 196.1 bits (497), Expect = 5.9e-47 Identity = 98/148 (66.22%), Postives = 116/148 (78.38%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|