MELO3C026073 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATCGTCACCCATAGCAACCTCCTTTTTTTCTCTATATTTCTCTCATTCTCTTTCTCCATGGACATCCAAGCAAAGCTTCTCCAACACAAAGACCAAATAACTGTTGTAGCAGCAGTTTCAGTTGTTCTGTCATTGTTTGTATATGTAGCCCCTCGGTTTCTAAGTATTCTAGCTTTCTTTTGGCCTCTCTTTGCCTCCACAGCTGTGCTCTTGGTGGTAATGACCGCCTTTGGAGGTGGTTTCCAAGTCGGAAGCGAGATTCATGGTATGAGAGCTGGTGAAGGAATTCTGGATTATGTTGCAGGACGACCTGAAAATGGCGAAAACCACTATAAGTACCAATAAAGAGATTATTTGTCACAATCAAATTTAAACAACATATATTCAAAATTTCTGTCTGTTCATTTTGTATATTTAAACTACCAATGAGTTAGTTCAGTGAAATAACCACATGGATGCTCAATGCA ATCGTCACCCATAGCAACCTCCTTTTTTTCTCTATATTTCTCTCATTCTCTTTCTCCATGGACATCCAAGCAAAGCTTCTCCAACACAAAGACCAAATAACTGTTGTAGCAGCAGTTTCAGTTGTTCTGTCATTGTTTGTATATGTAGCCCCTCGGTTTCTAAGTATTCTAGCTTTCTTTTGGCCTCTCTTTGCCTCCACAGCTGTGCTCTTGGTGGTAATGACCGCCTTTGGAGGTGGTTTCCAAGTCGGAAGCGAGATTCATGGTATGAGAGCTGGTGAAGGAATTCTGGATTATGTTGCAGGACGACCTGAAAATGGCGAAAACCACTATAAGTACCAATAAAGAGATTATTTGTCACAATCAAATTTAAACAACATATATTCAAAATTTCTGTCTGTTCATTTTGTATATTTAAACTACCAATGAGTTAGTTCAGTGAAATAACCACATGGATGCTCAATGCA ATGGACATCCAAGCAAAGCTTCTCCAACACAAAGACCAAATAACTGTTGTAGCAGCAGTTTCAGTTGTTCTGTCATTGTTTGTATATGTAGCCCCTCGGTTTCTAAGTATTCTAGCTTTCTTTTGGCCTCTCTTTGCCTCCACAGCTGTGCTCTTGGTGGTAATGACCGCCTTTGGAGGTGGTTTCCAAGTCGGAAGCGAGATTCATGGTATGAGAGCTGGTGAAGGAATTCTGGATTATGTTGCAGGACGACCTGAAAATGGCGAAAACCACTATAAGTACCAATAA MDIQAKLLQHKDQITVVAAVSVVLSLFVYVAPRFLSILAFFWPLFASTAVLLVVMTAFGGGFQVGSEIHGMRAGEGILDYVAGRPENGENHYKYQ*
BLAST of MELO3C026073 vs. TrEMBL
Match: A0A0A0LYI8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G173160 PE=4 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 3.0e-43 Identity = 89/95 (93.68%), Postives = 92/95 (96.84%), Query Frame = 1
BLAST of MELO3C026073 vs. TrEMBL
Match: A0A061GGG1_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_030419 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 2.3e-22 Identity = 49/95 (51.58%), Postives = 70/95 (73.68%), Query Frame = 1
BLAST of MELO3C026073 vs. TrEMBL
Match: D7T5G5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_00s0194g00220 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.7e-20 Identity = 50/86 (58.14%), Postives = 64/86 (74.42%), Query Frame = 1
BLAST of MELO3C026073 vs. TrEMBL
Match: I1MFR0_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_15G117900 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.7e-20 Identity = 51/87 (58.62%), Postives = 65/87 (74.71%), Query Frame = 1
BLAST of MELO3C026073 vs. TrEMBL
Match: B9HD48_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s01890g PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.7e-20 Identity = 50/96 (52.08%), Postives = 68/96 (70.83%), Query Frame = 1
BLAST of MELO3C026073 vs. TAIR10
Match: AT4G16400.1 (AT4G16400.1 unknown protein) HSP 1 Score: 88.2 bits (217), Expect = 3.0e-18 Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 1
BLAST of MELO3C026073 vs. TAIR10
Match: AT3G13175.1 (AT3G13175.1 unknown protein) HSP 1 Score: 56.6 bits (135), Expect = 9.7e-09 Identity = 36/91 (39.56%), Postives = 49/91 (53.85%), Query Frame = 1
BLAST of MELO3C026073 vs. NCBI nr
Match: gi|659128598|ref|XP_008464280.1| (PREDICTED: uncharacterized protein LOC103502206 [Cucumis melo]) HSP 1 Score: 190.7 bits (483), Expect = 1.2e-45 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of MELO3C026073 vs. NCBI nr
Match: gi|700209900|gb|KGN64996.1| (hypothetical protein Csa_1G173160 [Cucumis sativus]) HSP 1 Score: 182.2 bits (461), Expect = 4.3e-43 Identity = 89/95 (93.68%), Postives = 92/95 (96.84%), Query Frame = 1
BLAST of MELO3C026073 vs. NCBI nr
Match: gi|590627047|ref|XP_007026343.1| (Uncharacterized protein TCM_030419 [Theobroma cacao]) HSP 1 Score: 112.8 bits (281), Expect = 3.2e-22 Identity = 49/95 (51.58%), Postives = 70/95 (73.68%), Query Frame = 1
BLAST of MELO3C026073 vs. NCBI nr
Match: gi|224089775|ref|XP_002308811.1| (hypothetical protein POPTR_0006s01890g [Populus trichocarpa]) HSP 1 Score: 105.1 bits (261), Expect = 6.7e-20 Identity = 50/96 (52.08%), Postives = 68/96 (70.83%), Query Frame = 1
BLAST of MELO3C026073 vs. NCBI nr
Match: gi|947062314|gb|KRH11575.1| (hypothetical protein GLYMA_15G117900 [Glycine max]) HSP 1 Score: 105.1 bits (261), Expect = 6.7e-20 Identity = 51/87 (58.62%), Postives = 65/87 (74.71%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|