Csa1G173160 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TCTCTCATTCTCCTTCTCCTTCTCCATGGACATTCATGCAAAGGTTCTCCAACACAAAGACCAACTAACTGTTGTAGCAGCAGTTTCAGTTGTTCTGTCATTGTTTGTATATGCAGCTCCTCGATTTCTAAGTATTCTAGCTTTCTTTTGGCCTCTCTTTGCCTCCACAGCTGTACTCTTAGTGGTAATGAACGCCTTTGGAGGTGGTTTCCAAGTCGGAACCGAGATTCATGGTATGAGAGCTGGTGAAGGGATTCTAGATTATGTTGCGGGAAGACCTGAAAATGGCGAAAACCACTATAAGTACCAATAACAGATTATTTCTCACGATCAAATTTAAAAAACATACACTCAAAGTTTCTGCTTGTTCATTTTGTATATTCAAACTACCGATGAGTTAGTTCAGTGGAATAACACATGGATGCTCAATGCAAAAAATGGTTTGTAAATTGAATGTAATTCTTCAAATATTTTGTTTGAATCCTAATAGGTAAGTTCAGTAACGATATTTGGAATCAATGGTCACTTAAAAGGTAACCATGAAAATGAAATTTATAGTATCTGCCTC ATGGACATTCATGCAAAGGTTCTCCAACACAAAGACCAACTAACTGTTGTAGCAGCAGTTTCAGTTGTTCTGTCATTGTTTGTATATGCAGCTCCTCGATTTCTAAGTATTCTAGCTTTCTTTTGGCCTCTCTTTGCCTCCACAGCTGTACTCTTAGTGGTAATGAACGCCTTTGGAGGTGGTTTCCAAGTCGGAACCGAGATTCATGGTATGAGAGCTGGTGAAGGGATTCTAGATTATGTTGCGGGAAGACCTGAAAATGGCGAAAACCACTATAAGTACCAATAA ATGGACATTCATGCAAAGGTTCTCCAACACAAAGACCAACTAACTGTTGTAGCAGCAGTTTCAGTTGTTCTGTCATTGTTTGTATATGCAGCTCCTCGATTTCTAAGTATTCTAGCTTTCTTTTGGCCTCTCTTTGCCTCCACAGCTGTACTCTTAGTGGTAATGAACGCCTTTGGAGGTGGTTTCCAAGTCGGAACCGAGATTCATGGTATGAGAGCTGGTGAAGGGATTCTAGATTATGTTGCGGGAAGACCTGAAAATGGCGAAAACCACTATAAGTACCAATAA MDIHAKVLQHKDQLTVVAAVSVVLSLFVYAAPRFLSILAFFWPLFASTAVLLVVMNAFGGGFQVGTEIHGMRAGEGILDYVAGRPENGENHYKYQ*
BLAST of Csa1G173160 vs. TrEMBL
Match: A0A0A0LYI8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G173160 PE=4 SV=1) HSP 1 Score: 192.6 bits (488), Expect = 2.2e-46 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Csa1G173160 vs. TrEMBL
Match: A0A061GGG1_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_030419 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.3e-21 Identity = 47/95 (49.47%), Postives = 68/95 (71.58%), Query Frame = 1
BLAST of Csa1G173160 vs. TrEMBL
Match: B9HD48_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s01890g PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.8e-20 Identity = 51/96 (53.12%), Postives = 69/96 (71.88%), Query Frame = 1
BLAST of Csa1G173160 vs. TrEMBL
Match: A0A0B2S7V4_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_015170 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.4e-19 Identity = 50/86 (58.14%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of Csa1G173160 vs. TrEMBL
Match: I1L024_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_09G013000 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.4e-19 Identity = 50/86 (58.14%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of Csa1G173160 vs. TAIR10
Match: AT4G16400.1 (AT4G16400.1 unknown protein) HSP 1 Score: 85.5 bits (210), Expect = 1.9e-17 Identity = 43/91 (47.25%), Postives = 58/91 (63.74%), Query Frame = 1
BLAST of Csa1G173160 vs. TAIR10
Match: AT3G13175.1 (AT3G13175.1 unknown protein) HSP 1 Score: 53.9 bits (128), Expect = 6.3e-08 Identity = 34/91 (37.36%), Postives = 47/91 (51.65%), Query Frame = 1
BLAST of Csa1G173160 vs. NCBI nr
Match: gi|700209900|gb|KGN64996.1| (hypothetical protein Csa_1G173160 [Cucumis sativus]) HSP 1 Score: 192.6 bits (488), Expect = 3.2e-46 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Csa1G173160 vs. NCBI nr
Match: gi|659128598|ref|XP_008464280.1| (PREDICTED: uncharacterized protein LOC103502206 [Cucumis melo]) HSP 1 Score: 182.2 bits (461), Expect = 4.3e-43 Identity = 89/95 (93.68%), Postives = 92/95 (96.84%), Query Frame = 1
BLAST of Csa1G173160 vs. NCBI nr
Match: gi|590627047|ref|XP_007026343.1| (Uncharacterized protein TCM_030419 [Theobroma cacao]) HSP 1 Score: 109.0 bits (271), Expect = 4.7e-21 Identity = 47/95 (49.47%), Postives = 68/95 (71.58%), Query Frame = 1
BLAST of Csa1G173160 vs. NCBI nr
Match: gi|224089775|ref|XP_002308811.1| (hypothetical protein POPTR_0006s01890g [Populus trichocarpa]) HSP 1 Score: 105.9 bits (263), Expect = 4.0e-20 Identity = 51/96 (53.12%), Postives = 69/96 (71.88%), Query Frame = 1
BLAST of Csa1G173160 vs. NCBI nr
Match: gi|734420416|gb|KHN40803.1| (hypothetical protein glysoja_015170 [Glycine soja]) HSP 1 Score: 103.6 bits (257), Expect = 2.0e-19 Identity = 50/86 (58.14%), Postives = 65/86 (75.58%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |