Cp4.1LG08g05510 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGGGAAGATCAAAGTCCATGAAATGCTTCTCAATTTGCAGCATCTTTAAGAGCTGTTGCTTTTCAAAGGGTGGAAGAGATGAAGGGTATTGGGATGAAAGTGGTGAGATTAGGCGTAGGATGTGGCCTAGTGATGAAGATACAAGATGGGTGGCTGAGCCTGGGATTGATCGGAAAGCTTCTGCTTTTATTGCTAGATTCTATGACGCTCGTGTTTCTGATCCCGAACGACAAACGCTTGCTGTTTAG ATGGGGGGAAGATCAAAGTCCATGAAATGCTTCTCAATTTGCAGCATCTTTAAGAGCTGTTGCTTTTCAAAGGGTGGAAGAGATGAAGGGTATTGGGATGAAAGTGGTGAGATTAGGCGTAGGATGTGGCCTAGTGATGAAGATACAAGATGGGTGGCTGAGCCTGGGATTGATCGGAAAGCTTCTGCTTTTATTGCTAGATTCTATGACGCTCGTGTTTCTGATCCCGAACGACAAACGCTTGCTGTTTAG ATGGGGGGAAGATCAAAGTCCATGAAATGCTTCTCAATTTGCAGCATCTTTAAGAGCTGTTGCTTTTCAAAGGGTGGAAGAGATGAAGGGTATTGGGATGAAAGTGGTGAGATTAGGCGTAGGATGTGGCCTAGTGATGAAGATACAAGATGGGTGGCTGAGCCTGGGATTGATCGGAAAGCTTCTGCTTTTATTGCTAGATTCTATGACGCTCGTGTTTCTGATCCCGAACGACAAACGCTTGCTGTTTAG MGGRSKSMKCFSICSIFKSCCFSKGGRDEGYWDESGEIRRRMWPSDEDTRWVAEPGIDRKASAFIARFYDARVSDPERQTLAV
BLAST of Cp4.1LG08g05510 vs. TrEMBL
Match: W9RIP1_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_026133 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.9e-19 Identity = 56/85 (65.88%), Postives = 64/85 (75.29%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. TrEMBL
Match: A0A0A0LAW1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171730 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.7e-18 Identity = 51/68 (75.00%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. TrEMBL
Match: E5GC50_CUCME (Putative uncharacterized protein OS=Cucumis melo subsp. melo PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.9e-18 Identity = 50/67 (74.63%), Postives = 57/67 (85.07%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. TrEMBL
Match: B9HXC1_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0010s00650g PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.1e-17 Identity = 58/88 (65.91%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. TrEMBL
Match: A5C459_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0020g01000 PE=4 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.9e-15 Identity = 52/81 (64.20%), Postives = 56/81 (69.14%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. TAIR10
Match: AT3G05858.1 (AT3G05858.1 unknown protein) HSP 1 Score: 77.4 bits (189), Expect = 4.6e-15 Identity = 49/85 (57.65%), Postives = 58/85 (68.24%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. TAIR10
Match: AT5G26620.1 (AT5G26620.1 unknown protein) HSP 1 Score: 66.2 bits (160), Expect = 1.1e-11 Identity = 32/43 (74.42%), Postives = 37/43 (86.05%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. TAIR10
Match: AT1G48325.1 (AT1G48325.1 Expressed protein) HSP 1 Score: 50.8 bits (120), Expect = 4.6e-07 Identity = 30/81 (37.04%), Postives = 49/81 (60.49%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. NCBI nr
Match: gi|659077069|ref|XP_008439016.1| (PREDICTED: uncharacterized protein LOC103483934 [Cucumis melo]) HSP 1 Score: 139.4 bits (350), Expect = 2.8e-30 Identity = 68/91 (74.73%), Postives = 76/91 (83.52%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. NCBI nr
Match: gi|703107460|ref|XP_010098752.1| (hypothetical protein L484_026133 [Morus notabilis]) HSP 1 Score: 101.3 bits (251), Expect = 8.4e-19 Identity = 56/85 (65.88%), Postives = 64/85 (75.29%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. NCBI nr
Match: gi|700202083|gb|KGN57216.1| (hypothetical protein Csa_3G171730 [Cucumis sativus]) HSP 1 Score: 99.8 bits (247), Expect = 2.4e-18 Identity = 51/68 (75.00%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. NCBI nr
Match: gi|307136210|gb|ADN34048.1| (hypothetical protein [Cucumis melo subsp. melo]) HSP 1 Score: 99.0 bits (245), Expect = 4.2e-18 Identity = 50/67 (74.63%), Postives = 57/67 (85.07%), Query Frame = 1
BLAST of Cp4.1LG08g05510 vs. NCBI nr
Match: gi|224106998|ref|XP_002314338.1| (hypothetical protein POPTR_0010s00650g [Populus trichocarpa]) HSP 1 Score: 97.1 bits (240), Expect = 1.6e-17 Identity = 58/88 (65.91%), Postives = 60/88 (68.18%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|