Csa3G171730 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAGGAAGAGATTATGGGAATGACTATGAAGGTCATTATTTTGAAGATCAAAGTGGTGAAATTAGAAGAAGGATGTGGCCAAGTGATGAAGATAGAGGAAGTAGATGGGTTGCTGAGCCTGGAATTGATCGTAAAGCTTCTGCTTTTATTGCTAGATTCTACGAAGCTCGTGTTTCCGATCCCGAACGCCAAACTCTTTCTCTTTAA ATGGGAGGAAGAGATTATGGGAATGACTATGAAGGTCATTATTTTGAAGATCAAAGTGGTGAAATTAGAAGAAGGATGTGGCCAAGTGATGAAGATAGAGGAAGTAGATGGGTTGCTGAGCCTGGAATTGATCGTAAAGCTTCTGCTTTTATTGCTAGATTCTACGAAGCTCGTGTTTCCGATCCCGAACGCCAAACTCTTTCTCTTTAA ATGGGAGGAAGAGATTATGGGAATGACTATGAAGGTCATTATTTTGAAGATCAAAGTGGTGAAATTAGAAGAAGGATGTGGCCAAGTGATGAAGATAGAGGAAGTAGATGGGTTGCTGAGCCTGGAATTGATCGTAAAGCTTCTGCTTTTATTGCTAGATTCTACGAAGCTCGTGTTTCCGATCCCGAACGCCAAACTCTTTCTCTTTAA MGGRDYGNDYEGHYFEDQSGEIRRRMWPSDEDRGSRWVAEPGIDRKASAFIARFYEARVSDPERQTLSL*
BLAST of Csa3G171730 vs. TrEMBL
Match: A0A0A0LAW1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171730 PE=4 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 2.7e-33 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Csa3G171730 vs. TrEMBL
Match: E5GC50_CUCME (Putative uncharacterized protein OS=Cucumis melo subsp. melo PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 8.1e-30 Identity = 66/69 (95.65%), Postives = 67/69 (97.10%), Query Frame = 1
BLAST of Csa3G171730 vs. TrEMBL
Match: W9RIP1_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_026133 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 2.8e-14 Identity = 46/66 (69.70%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of Csa3G171730 vs. TrEMBL
Match: A0A067E1Z2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g038144mg PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.7e-11 Identity = 34/48 (70.83%), Postives = 41/48 (85.42%), Query Frame = 1
BLAST of Csa3G171730 vs. TrEMBL
Match: V4S2I2_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10013220mg PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.7e-11 Identity = 34/48 (70.83%), Postives = 41/48 (85.42%), Query Frame = 1
BLAST of Csa3G171730 vs. TAIR10
Match: AT5G26620.1 (AT5G26620.1 unknown protein) HSP 1 Score: 64.3 bits (155), Expect = 3.4e-11 Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 1
BLAST of Csa3G171730 vs. TAIR10
Match: AT3G05858.1 (AT3G05858.1 unknown protein) HSP 1 Score: 61.2 bits (147), Expect = 2.9e-10 Identity = 34/52 (65.38%), Postives = 37/52 (71.15%), Query Frame = 1
BLAST of Csa3G171730 vs. NCBI nr
Match: gi|700202083|gb|KGN57216.1| (hypothetical protein Csa_3G171730 [Cucumis sativus]) HSP 1 Score: 148.7 bits (374), Expect = 3.9e-33 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Csa3G171730 vs. NCBI nr
Match: gi|659077069|ref|XP_008439016.1| (PREDICTED: uncharacterized protein LOC103483934 [Cucumis melo]) HSP 1 Score: 137.1 bits (344), Expect = 1.2e-29 Identity = 66/69 (95.65%), Postives = 67/69 (97.10%), Query Frame = 1
BLAST of Csa3G171730 vs. NCBI nr
Match: gi|307136210|gb|ADN34048.1| (hypothetical protein [Cucumis melo subsp. melo]) HSP 1 Score: 137.1 bits (344), Expect = 1.2e-29 Identity = 66/69 (95.65%), Postives = 67/69 (97.10%), Query Frame = 1
BLAST of Csa3G171730 vs. NCBI nr
Match: gi|703107460|ref|XP_010098752.1| (hypothetical protein L484_026133 [Morus notabilis]) HSP 1 Score: 85.5 bits (210), Expect = 4.0e-14 Identity = 46/66 (69.70%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of Csa3G171730 vs. NCBI nr
Match: gi|657995939|ref|XP_008390328.1| (PREDICTED: uncharacterized protein LOC103452598 [Malus domestica]) HSP 1 Score: 77.8 bits (190), Expect = 8.4e-12 Identity = 38/62 (61.29%), Postives = 47/62 (75.81%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|