CmaCh17G003240 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTATCTCACGCGTTTCTGCTCTCATTGCTGCGTTCGCCGTTCTCGCCGCTCATTTTCTGATCTCATCGGCAACGGCCATCGATTTCTCCGGCGACAACGAGATTCTCTTTGCTCCGACTAAATCCGAGTGCCGAGGCTCAATCACCGAGTGCTTTCTCGCTGGAAACTATGACGATTCCGGCTTCGGAATGGAGTTCGAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGACTACTCGCTACATCAGCTATGGTGCTCTGAGGAGGAACAACGTTCCTTGCTCCCGCCGCGGCGCTTCTTACTACAACTGTCGTCCAGGCGCTCAGGCGAATCCTTACACCCGTGGTTGTAGCGCCATTACTCGCTGCCGAAGTTAA ATGGGTATCTCACGCGTTTCTGCTCTCATTGCTGCGTTCGCCGTTCTCGCCGCTCATTTTCTGATCTCATCGGCAACGGCCATCGATTTCTCCGGCGACAACGAGATTCTCTTTGCTCCGACTAAATCCGAGTGCCGAGGCTCAATCACCGAGTGCTTTCTCGCTGGAAACTATGACGATTCCGGCTTCGGAATGGAGTTCGAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGACTACTCGCTACATCAGCTATGGTGCTCTGAGGAGGAACAACGTTCCTTGCTCCCGCCGCGGCGCTTCTTACTACAACTGTCGTCCAGGCGCTCAGGCGAATCCTTACACCCGTGGTTGTAGCGCCATTACTCGCTGCCGAAGTTAA ATGGGTATCTCACGCGTTTCTGCTCTCATTGCTGCGTTCGCCGTTCTCGCCGCTCATTTTCTGATCTCATCGGCAACGGCCATCGATTTCTCCGGCGACAACGAGATTCTCTTTGCTCCGACTAAATCCGAGTGCCGAGGCTCAATCACCGAGTGCTTTCTCGCTGGAAACTATGACGATTCCGGCTTCGGAATGGAGTTCGAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGACTACTCGCTACATCAGCTATGGTGCTCTGAGGAGGAACAACGTTCCTTGCTCCCGCCGCGGCGCTTCTTACTACAACTGTCGTCCAGGCGCTCAGGCGAATCCTTACACCCGTGGTTGTAGCGCCATTACTCGCTGCCGAAGTTAA MGISRVSALIAAFAVLAAHFLISSATAIDFSGDNEILFAPTKSECRGSITECFLAGNYDDSGFGMEFEMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPYTRGCSAITRCRS
BLAST of CmaCh17G003240 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 3.7e-34 Identity = 82/138 (59.42%), Postives = 96/138 (69.57%), Query Frame = 1
BLAST of CmaCh17G003240 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 2.4e-33 Identity = 75/113 (66.37%), Postives = 86/113 (76.11%), Query Frame = 1
BLAST of CmaCh17G003240 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.6e-29 Identity = 68/113 (60.18%), Postives = 80/113 (70.80%), Query Frame = 1
BLAST of CmaCh17G003240 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.2e-24 Identity = 66/123 (53.66%), Postives = 77/123 (62.60%), Query Frame = 1
BLAST of CmaCh17G003240 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 7.8e-24 Identity = 64/127 (50.39%), Postives = 79/127 (62.20%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TrEMBL
Match: A0A0A0KBU7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G194150 PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 5.6e-45 Identity = 97/127 (76.38%), Postives = 106/127 (83.46%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TrEMBL
Match: A0A0D2TAB6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G190000 PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 8.1e-36 Identity = 86/128 (67.19%), Postives = 94/128 (73.44%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TrEMBL
Match: A0A061EQ76_THECC (Rapid alkalinization factor 1, putative OS=Theobroma cacao GN=TCM_021204 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 6.8e-35 Identity = 85/129 (65.89%), Postives = 98/129 (75.97%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TrEMBL
Match: G7JLH2_MEDTR (RALF OS=Medicago truncatula GN=MTR_4g119860 PE=4 SV=2) HSP 1 Score: 152.9 bits (385), Expect = 2.6e-34 Identity = 81/117 (69.23%), Postives = 92/117 (78.63%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TrEMBL
Match: A5BA80_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0060g02150 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.6e-34 Identity = 78/121 (64.46%), Postives = 95/121 (78.51%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 145.6 bits (366), Expect = 2.1e-35 Identity = 82/138 (59.42%), Postives = 96/138 (69.57%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 142.9 bits (359), Expect = 1.4e-34 Identity = 75/113 (66.37%), Postives = 86/113 (76.11%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 114.0 bits (284), Expect = 6.8e-26 Identity = 66/123 (53.66%), Postives = 77/123 (62.60%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 111.3 bits (277), Expect = 4.4e-25 Identity = 64/127 (50.39%), Postives = 79/127 (62.20%), Query Frame = 1
BLAST of CmaCh17G003240 vs. TAIR10
Match: AT2G33775.1 (AT2G33775.1 ralf-like 19) HSP 1 Score: 89.0 bits (219), Expect = 2.3e-18 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of CmaCh17G003240 vs. NCBI nr
Match: gi|449450680|ref|XP_004143090.1| (PREDICTED: protein RALF-like 33 [Cucumis sativus]) HSP 1 Score: 188.3 bits (477), Expect = 8.0e-45 Identity = 97/127 (76.38%), Postives = 106/127 (83.46%), Query Frame = 1
BLAST of CmaCh17G003240 vs. NCBI nr
Match: gi|659117160|ref|XP_008458453.1| (PREDICTED: protein RALF-like 33 [Cucumis melo]) HSP 1 Score: 185.7 bits (470), Expect = 5.2e-44 Identity = 97/128 (75.78%), Postives = 109/128 (85.16%), Query Frame = 1
BLAST of CmaCh17G003240 vs. NCBI nr
Match: gi|823244996|ref|XP_012455175.1| (PREDICTED: protein RALF-like 33 [Gossypium raimondii]) HSP 1 Score: 157.9 bits (398), Expect = 1.2e-35 Identity = 86/128 (67.19%), Postives = 94/128 (73.44%), Query Frame = 1
BLAST of CmaCh17G003240 vs. NCBI nr
Match: gi|763805740|gb|KJB72678.1| (hypothetical protein B456_011G190000 [Gossypium raimondii]) HSP 1 Score: 157.9 bits (398), Expect = 1.2e-35 Identity = 86/128 (67.19%), Postives = 94/128 (73.44%), Query Frame = 1
BLAST of CmaCh17G003240 vs. NCBI nr
Match: gi|720043259|ref|XP_010269500.1| (PREDICTED: rapid alkalinization factor-like [Nelumbo nucifera]) HSP 1 Score: 154.8 bits (390), Expect = 9.8e-35 Identity = 78/121 (64.46%), Postives = 90/121 (74.38%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|