Carg18842 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAATCTCACGCGTTTTTTCCTTCCTCGCGGCCTCCGCCATTATCGCCGCTCACTTTCTGCTCTCATCGGCGATGGCCGTCGATTTCTCCGGCGGTGACAAACTCCTCTTCGTTCCGGCTGAGTCCAAGTGCAGAGGCTCTATCGCTGAATGCTTTCTCGCCGGAGATGACAATGATTCCGCCTTCGGAATGGAGTTCGAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGGCTTCTCGCTACCTGAGCTATGGCGCTTTGAAAAGGAACAGCGTTCCTTGCTCTCGCCGCGGTGCTTCTTACTACAACTGCCAGCCTGGCGCTCAGGCCAATCCTTACAGACGCGGTTGCAACGCCATTACTCGCTGCCGGAGTTAA ATGGAAATCTCACGCGTTTTTTCCTTCCTCGCGGCCTCCGCCATTATCGCCGCTCACTTTCTGCTCTCATCGGCGATGGCCGTCGATTTCTCCGGCGGTGACAAACTCCTCTTCGTTCCGGCTGAGTCCAAGTGCAGAGGCTCTATCGCTGAATGCTTTCTCGCCGGAGATGACAATGATTCCGCCTTCGGAATGGAGTTCGAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGGCTTCTCGCTACCTGAGCTATGGCGCTTTGAAAAGGAACAGCGTTCCTTGCTCTCGCCGCGGTGCTTCTTACTACAACTGCCAGCCTGGCGCTCAGGCCAATCCTTACAGACGCGGTTGCAACGCCATTACTCGCTGCCGGAGTTAA ATGGAAATCTCACGCGTTTTTTCCTTCCTCGCGGCCTCCGCCATTATCGCCGCTCACTTTCTGCTCTCATCGGCGATGGCCGTCGATTTCTCCGGCGGTGACAAACTCCTCTTCGTTCCGGCTGAGTCCAAGTGCAGAGGCTCTATCGCTGAATGCTTTCTCGCCGGAGATGACAATGATTCCGCCTTCGGAATGGAGTTCGAGATGGACTCTGAGATCAATCGCCGAATTCTAGCGGCTTCTCGCTACCTGAGCTATGGCGCTTTGAAAAGGAACAGCGTTCCTTGCTCTCGCCGCGGTGCTTCTTACTACAACTGCCAGCCTGGCGCTCAGGCCAATCCTTACAGACGCGGTTGCAACGCCATTACTCGCTGCCGGAGTTAA MEISRVFSFLAASAIIAAHFLLSSAMAVDFSGGDKLLFVPAESKCRGSIAECFLAGDDNDSAFGMEFEMDSEINRRILAASRYLSYGALKRNSVPCSRRGASYYNCQPGAQANPYRRGCNAITRCRS
BLAST of Carg18842 vs. NCBI nr
Match: XP_022930438.1 (protein RALF-like 33 [Cucurbita moschata] >XP_023514647.1 protein RALF-like 33 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 250.8 bits (639), Expect = 2.6e-63 Identity = 126/127 (99.21%), Postives = 127/127 (100.00%), Query Frame = 0
BLAST of Carg18842 vs. NCBI nr
Match: XP_023000591.1 (protein RALF-like 33 [Cucurbita maxima]) HSP 1 Score: 247.7 bits (631), Expect = 2.2e-62 Identity = 125/127 (98.43%), Postives = 125/127 (98.43%), Query Frame = 0
BLAST of Carg18842 vs. NCBI nr
Match: XP_022138421.1 (protein RALF-like 33 [Momordica charantia]) HSP 1 Score: 203.0 bits (515), Expect = 6.1e-49 Identity = 105/127 (82.68%), Postives = 110/127 (86.61%), Query Frame = 0
BLAST of Carg18842 vs. NCBI nr
Match: XP_022959207.1 (protein RALF-like 33 [Cucurbita moschata]) HSP 1 Score: 202.6 bits (514), Expect = 8.0e-49 Identity = 96/127 (75.59%), Postives = 115/127 (90.55%), Query Frame = 0
BLAST of Carg18842 vs. NCBI nr
Match: XP_023547686.1 (protein RALF-like 33 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 201.4 bits (511), Expect = 1.8e-48 Identity = 95/127 (74.80%), Postives = 115/127 (90.55%), Query Frame = 0
BLAST of Carg18842 vs. TAIR10
Match: AT4G15800.1 (ralf-like 33) HSP 1 Score: 138.3 bits (347), Expect = 3.4e-33 Identity = 73/113 (64.60%), Postives = 84/113 (74.34%), Query Frame = 0
BLAST of Carg18842 vs. TAIR10
Match: AT3G16570.1 (rapid alkalinization factor 23) HSP 1 Score: 131.3 bits (329), Expect = 4.1e-31 Identity = 72/129 (55.81%), Postives = 90/129 (69.77%), Query Frame = 0
BLAST of Carg18842 vs. TAIR10
Match: AT3G05490.1 (ralf-like 22) HSP 1 Score: 117.1 bits (292), Expect = 8.0e-27 Identity = 61/99 (61.62%), Postives = 69/99 (69.70%), Query Frame = 0
BLAST of Carg18842 vs. TAIR10
Match: AT1G02900.1 (rapid alkalinization factor 1) HSP 1 Score: 115.9 bits (289), Expect = 1.8e-26 Identity = 58/85 (68.24%), Postives = 65/85 (76.47%), Query Frame = 0
BLAST of Carg18842 vs. TAIR10
Match: AT2G33775.1 (ralf-like 19) HSP 1 Score: 87.0 bits (214), Expect = 8.9e-18 Identity = 42/71 (59.15%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of Carg18842 vs. Swiss-Prot
Match: sp|Q8L9P8|RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 6.0e-32 Identity = 73/113 (64.60%), Postives = 84/113 (74.34%), Query Frame = 0
BLAST of Carg18842 vs. Swiss-Prot
Match: sp|Q9LUS7|RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana OX=3702 GN=RALF23 PE=1 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 7.4e-30 Identity = 72/129 (55.81%), Postives = 90/129 (69.77%), Query Frame = 0
BLAST of Carg18842 vs. Swiss-Prot
Match: sp|Q945T0|RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 4.1e-28 Identity = 63/113 (55.75%), Postives = 78/113 (69.03%), Query Frame = 0
BLAST of Carg18842 vs. Swiss-Prot
Match: sp|Q9MA62|RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.4e-25 Identity = 61/99 (61.62%), Postives = 69/99 (69.70%), Query Frame = 0
BLAST of Carg18842 vs. Swiss-Prot
Match: sp|Q9SRY3|RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 3.2e-25 Identity = 58/85 (68.24%), Postives = 65/85 (76.47%), Query Frame = 0
BLAST of Carg18842 vs. TrEMBL
Match: tr|A0A1S3C7V8|A0A1S3C7V8_CUCME (protein RALF-like 33 OS=Cucumis melo OX=3656 GN=LOC103497855 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 3.5e-37 Identity = 89/128 (69.53%), Postives = 99/128 (77.34%), Query Frame = 0
BLAST of Carg18842 vs. TrEMBL
Match: tr|A0A0A0KBU7|A0A0A0KBU7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194150 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 3.0e-36 Identity = 84/127 (66.14%), Postives = 96/127 (75.59%), Query Frame = 0
BLAST of Carg18842 vs. TrEMBL
Match: tr|A0A2P5E484|A0A2P5E484_PARAD (Rapid ALkalinization Factor OS=Parasponia andersonii OX=3476 GN=PanWU01x14_008020 PE=4 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 5.1e-36 Identity = 79/123 (64.23%), Postives = 97/123 (78.86%), Query Frame = 0
BLAST of Carg18842 vs. TrEMBL
Match: tr|V4U0Q4|V4U0Q4_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10006201mg PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 1.5e-35 Identity = 80/122 (65.57%), Postives = 93/122 (76.23%), Query Frame = 0
BLAST of Carg18842 vs. TrEMBL
Match: tr|A0A067G7V9|A0A067G7V9_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g032876mg PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 1.5e-35 Identity = 80/122 (65.57%), Postives = 93/122 (76.23%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|