Cp4.1LG12g02690 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAATCTCACGCGTTTCTGCTCTCATTGCTGCGTTCGTCGTTCTCGCTGCTCATTTTCTGATTTCATCGGCAACGGCCATCGATTTCTCCGGCGACAACGAGATTCTCTTTGCTCCGACTAAATCCGAGTGCCGAGGCTCAATCGCTGAGTGCTTTCTCGCTGGAAACAATGACGATTCCGGCTTCGGAATGGAGTTCGAGATGGACTCTGAAATCAATCGCCGAATTCTAGCGACTACTCGCTACATCAGCTATGGTGCTCTGAGGAGGAACAACGTTCCTTGCTCCCGCCGCGGCGCTTCTTACTACAACTGCCGTCCAGGCGCTCAGGCGAATCCTTACACCCGTGGTTGTAGCGCCATTACTCGCTGCCGAAGTTAA ATGGGAATCTCACGCGTTTCTGCTCTCATTGCTGCGTTCGTCGTTCTCGCTGCTCATTTTCTGATTTCATCGGCAACGGCCATCGATTTCTCCGGCGACAACGAGATTCTCTTTGCTCCGACTAAATCCGAGTGCCGAGGCTCAATCGCTGAGTGCTTTCTCGCTGGAAACAATGACGATTCCGGCTTCGGAATGGAGTTCGAGATGGACTCTGAAATCAATCGCCGAATTCTAGCGACTACTCGCTACATCAGCTATGGTGCTCTGAGGAGGAACAACGTTCCTTGCTCCCGCCGCGGCGCTTCTTACTACAACTGCCGTCCAGGCGCTCAGGCGAATCCTTACACCCGTGGTTGTAGCGCCATTACTCGCTGCCGAAGTTAA ATGGGAATCTCACGCGTTTCTGCTCTCATTGCTGCGTTCGTCGTTCTCGCTGCTCATTTTCTGATTTCATCGGCAACGGCCATCGATTTCTCCGGCGACAACGAGATTCTCTTTGCTCCGACTAAATCCGAGTGCCGAGGCTCAATCGCTGAGTGCTTTCTCGCTGGAAACAATGACGATTCCGGCTTCGGAATGGAGTTCGAGATGGACTCTGAAATCAATCGCCGAATTCTAGCGACTACTCGCTACATCAGCTATGGTGCTCTGAGGAGGAACAACGTTCCTTGCTCCCGCCGCGGCGCTTCTTACTACAACTGCCGTCCAGGCGCTCAGGCGAATCCTTACACCCGTGGTTGTAGCGCCATTACTCGCTGCCGAAGTTAA MGISRVSALIAAFVVLAAHFLISSATAIDFSGDNEILFAPTKSECRGSIAECFLAGNNDDSGFGMEFEMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPYTRGCSAITRCRS
BLAST of Cp4.1LG12g02690 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 3.7e-34 Identity = 82/138 (59.42%), Postives = 98/138 (71.01%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 1.4e-33 Identity = 75/112 (66.96%), Postives = 86/112 (76.79%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 1.2e-29 Identity = 68/113 (60.18%), Postives = 80/113 (70.80%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.1e-25 Identity = 67/123 (54.47%), Postives = 78/123 (63.41%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 7.8e-24 Identity = 64/127 (50.39%), Postives = 79/127 (62.20%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TrEMBL
Match: A0A0A0KBU7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G194150 PE=4 SV=1) HSP 1 Score: 191.4 bits (485), Expect = 6.6e-46 Identity = 96/127 (75.59%), Postives = 107/127 (84.25%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TrEMBL
Match: A0A0D2TAB6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G190000 PE=4 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 6.2e-36 Identity = 86/128 (67.19%), Postives = 94/128 (73.44%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TrEMBL
Match: A0A061EQ76_THECC (Rapid alkalinization factor 1, putative OS=Theobroma cacao GN=TCM_021204 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 5.2e-35 Identity = 85/129 (65.89%), Postives = 98/129 (75.97%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TrEMBL
Match: V4U0Q4_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10006201mg PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 5.2e-35 Identity = 82/130 (63.08%), Postives = 98/130 (75.38%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TrEMBL
Match: A0A067G7V9_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g032876mg PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 5.2e-35 Identity = 82/130 (63.08%), Postives = 98/130 (75.38%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 145.6 bits (366), Expect = 2.1e-35 Identity = 82/138 (59.42%), Postives = 98/138 (71.01%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 143.7 bits (361), Expect = 8.0e-35 Identity = 75/112 (66.96%), Postives = 86/112 (76.79%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 115.5 bits (288), Expect = 2.3e-26 Identity = 67/123 (54.47%), Postives = 78/123 (63.41%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 111.3 bits (277), Expect = 4.4e-25 Identity = 64/127 (50.39%), Postives = 79/127 (62.20%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. TAIR10
Match: AT2G33775.1 (AT2G33775.1 ralf-like 19) HSP 1 Score: 88.6 bits (218), Expect = 3.0e-18 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. NCBI nr
Match: gi|449450680|ref|XP_004143090.1| (PREDICTED: protein RALF-like 33 [Cucumis sativus]) HSP 1 Score: 191.4 bits (485), Expect = 9.5e-46 Identity = 96/127 (75.59%), Postives = 107/127 (84.25%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. NCBI nr
Match: gi|659117160|ref|XP_008458453.1| (PREDICTED: protein RALF-like 33 [Cucumis melo]) HSP 1 Score: 189.1 bits (479), Expect = 4.7e-45 Identity = 96/128 (75.00%), Postives = 110/128 (85.94%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. NCBI nr
Match: gi|823244996|ref|XP_012455175.1| (PREDICTED: protein RALF-like 33 [Gossypium raimondii]) HSP 1 Score: 158.3 bits (399), Expect = 8.9e-36 Identity = 86/128 (67.19%), Postives = 94/128 (73.44%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. NCBI nr
Match: gi|763805740|gb|KJB72678.1| (hypothetical protein B456_011G190000 [Gossypium raimondii]) HSP 1 Score: 158.3 bits (399), Expect = 8.9e-36 Identity = 86/128 (67.19%), Postives = 94/128 (73.44%), Query Frame = 1
BLAST of Cp4.1LG12g02690 vs. NCBI nr
Match: gi|720043259|ref|XP_010269500.1| (PREDICTED: rapid alkalinization factor-like [Nelumbo nucifera]) HSP 1 Score: 156.4 bits (394), Expect = 3.4e-35 Identity = 79/121 (65.29%), Postives = 91/121 (75.21%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|