Cucsa.172250 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAATCTCACGCGTTTCTTCTCTCCTTGCCGTCTTCCTCATTCTCGCTCCTCATTTTGTCTTCTCCATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCGACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTGGCGACTACTCGTTACATAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGCTCTCGTCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA ATGGGAATCTCACGCGTTTCTTCTCTCCTTGCCGTCTTCCTCATTCTCGCTCCTCATTTTGTCTTCTCCATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCGACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTGGCGACTACTCGTTACATAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGCTCTCGTCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA ATGGGAATCTCACGCGTTTCTTCTCTCCTTGCCGTCTTCCTCATTCTCGCTCCTCATTTTGTCTTCTCCATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCGACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTGGCGACTACTCGTTACATAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGCTCTCGTCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA MGISRVSSLLAVFLILAPHFVFSMAAAVDFSGDHELLFVPTTSDFFDDNDDFGFGMEFQMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPYTRGCSAITRCRS*
BLAST of Cucsa.172250 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.7e-28 Identity = 73/134 (54.48%), Postives = 85/134 (63.43%), Query Frame = 1
BLAST of Cucsa.172250 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.9e-28 Identity = 69/109 (63.30%), Postives = 76/109 (69.72%), Query Frame = 1
BLAST of Cucsa.172250 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 6.0e-26 Identity = 62/109 (56.88%), Postives = 78/109 (71.56%), Query Frame = 1
BLAST of Cucsa.172250 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.1e-23 Identity = 50/62 (80.65%), Postives = 57/62 (91.94%), Query Frame = 1
BLAST of Cucsa.172250 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.8e-22 Identity = 47/61 (77.05%), Postives = 55/61 (90.16%), Query Frame = 1
BLAST of Cucsa.172250 vs. TrEMBL
Match: A0A0A0KBU7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G194150 PE=4 SV=1) HSP 1 Score: 243.8 bits (621), Expect = 1.0e-61 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1
BLAST of Cucsa.172250 vs. TrEMBL
Match: A5BUA5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_037723 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.3e-30 Identity = 73/114 (64.04%), Postives = 87/114 (76.32%), Query Frame = 1
BLAST of Cucsa.172250 vs. TrEMBL
Match: F6HDF3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0020g01490 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.3e-30 Identity = 73/114 (64.04%), Postives = 87/114 (76.32%), Query Frame = 1
BLAST of Cucsa.172250 vs. TrEMBL
Match: A0A0D2TAB6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G190000 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.8e-30 Identity = 79/128 (61.72%), Postives = 86/128 (67.19%), Query Frame = 1
BLAST of Cucsa.172250 vs. TrEMBL
Match: A0A067G7V9_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g032876mg PE=4 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 4.0e-29 Identity = 72/121 (59.50%), Postives = 82/121 (67.77%), Query Frame = 1
BLAST of Cucsa.172250 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 126.7 bits (317), Expect = 9.5e-30 Identity = 73/134 (54.48%), Postives = 85/134 (63.43%), Query Frame = 1
BLAST of Cucsa.172250 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 125.9 bits (315), Expect = 1.6e-29 Identity = 69/109 (63.30%), Postives = 76/109 (69.72%), Query Frame = 1
BLAST of Cucsa.172250 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 109.8 bits (273), Expect = 1.2e-24 Identity = 50/62 (80.65%), Postives = 57/62 (91.94%), Query Frame = 1
BLAST of Cucsa.172250 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 106.7 bits (265), Expect = 1.0e-23 Identity = 47/61 (77.05%), Postives = 55/61 (90.16%), Query Frame = 1
BLAST of Cucsa.172250 vs. TAIR10
Match: AT2G33775.1 (AT2G33775.1 ralf-like 19) HSP 1 Score: 90.5 bits (223), Expect = 7.5e-19 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of Cucsa.172250 vs. NCBI nr
Match: gi|449450680|ref|XP_004143090.1| (PREDICTED: protein RALF-like 33 [Cucumis sativus]) HSP 1 Score: 243.8 bits (621), Expect = 1.5e-61 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1
BLAST of Cucsa.172250 vs. NCBI nr
Match: gi|659117160|ref|XP_008458453.1| (PREDICTED: protein RALF-like 33 [Cucumis melo]) HSP 1 Score: 224.9 bits (572), Expect = 7.2e-56 Identity = 110/119 (92.44%), Postives = 115/119 (96.64%), Query Frame = 1
BLAST of Cucsa.172250 vs. NCBI nr
Match: gi|147862659|emb|CAN83593.1| (hypothetical protein VITISV_037723 [Vitis vinifera]) HSP 1 Score: 140.6 bits (353), Expect = 1.8e-30 Identity = 73/114 (64.04%), Postives = 87/114 (76.32%), Query Frame = 1
BLAST of Cucsa.172250 vs. NCBI nr
Match: gi|225432308|ref|XP_002273386.1| (PREDICTED: protein RALF-like 33 [Vitis vinifera]) HSP 1 Score: 140.6 bits (353), Expect = 1.8e-30 Identity = 73/114 (64.04%), Postives = 87/114 (76.32%), Query Frame = 1
BLAST of Cucsa.172250 vs. NCBI nr
Match: gi|297736875|emb|CBI26076.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 140.6 bits (353), Expect = 1.8e-30 Identity = 73/114 (64.04%), Postives = 87/114 (76.32%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |