CsGy6G014610 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAATCTCACGCGTTTCTTCTCTCCTTGCCGTCTTCCTCATTCTCGCTCCTCATTTTGTCTTCTCCATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCGACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTGGCGACTACTCGTTACATAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGCTCTCGTCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA ATGGGAATCTCACGCGTTTCTTCTCTCCTTGCCGTCTTCCTCATTCTCGCTCCTCATTTTGTCTTCTCCATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCGACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTGGCGACTACTCGTTACATAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGCTCTCGTCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA ATGGGAATCTCACGCGTTTCTTCTCTCCTTGCCGTCTTCCTCATTCTCGCTCCTCATTTTGTCTTCTCCATGGCGGCCGCCGTCGATTTCTCTGGCGACCACGAGCTTCTCTTCGTTCCCACCACGTCCGATTTCTTCGACGACAACGATGATTTCGGTTTCGGAATGGAGTTCCAGATGGACTCTGAGATCAATCGCCGAATTCTGGCGACTACTCGTTACATAAGCTACGGTGCTCTTAGGAGGAACAATGTTCCTTGCTCTCGTCGTGGTGCTTCTTATTACAACTGCAGACCAGGTGCTCAGGCGAATCCTTACACCCGTGGTTGCAGCGCTATTACTCGCTGCAGAAGTTGA MGISRVSSLLAVFLILAPHFVFSMAAAVDFSGDHELLFVPTTSDFFDDNDDFGFGMEFQMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPYTRGCSAITRCRS
BLAST of CsGy6G014610 vs. NCBI nr
Match: XP_004143090.1 (PREDICTED: protein RALF-like 33 [Cucumis sativus] >KGN47180.1 hypothetical protein Csa_6G194150 [Cucumis sativus]) HSP 1 Score: 237.7 bits (605), Expect = 2.1e-59 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 0
BLAST of CsGy6G014610 vs. NCBI nr
Match: XP_008458453.1 (PREDICTED: protein RALF-like 33 [Cucumis melo]) HSP 1 Score: 218.8 bits (556), Expect = 1.0e-53 Identity = 110/119 (92.44%), Postives = 115/119 (96.64%), Query Frame = 0
BLAST of CsGy6G014610 vs. NCBI nr
Match: XP_023547686.1 (protein RALF-like 33 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 191.0 bits (484), Expect = 2.2e-45 Identity = 96/127 (75.59%), Postives = 107/127 (84.25%), Query Frame = 0
BLAST of CsGy6G014610 vs. NCBI nr
Match: XP_023006467.1 (protein RALF-like 33 [Cucurbita maxima]) HSP 1 Score: 188.0 bits (476), Expect = 1.9e-44 Identity = 97/127 (76.38%), Postives = 106/127 (83.46%), Query Frame = 0
BLAST of CsGy6G014610 vs. NCBI nr
Match: XP_022959207.1 (protein RALF-like 33 [Cucurbita moschata]) HSP 1 Score: 187.6 bits (475), Expect = 2.5e-44 Identity = 95/127 (74.80%), Postives = 106/127 (83.46%), Query Frame = 0
BLAST of CsGy6G014610 vs. TAIR10
Match: AT3G16570.1 (rapid alkalinization factor 23) HSP 1 Score: 120.9 bits (302), Expect = 5.1e-28 Identity = 73/134 (54.48%), Postives = 85/134 (63.43%), Query Frame = 0
BLAST of CsGy6G014610 vs. TAIR10
Match: AT4G15800.1 (ralf-like 33) HSP 1 Score: 120.2 bits (300), Expect = 8.8e-28 Identity = 69/109 (63.30%), Postives = 76/109 (69.72%), Query Frame = 0
BLAST of CsGy6G014610 vs. TAIR10
Match: AT1G02900.1 (rapid alkalinization factor 1) HSP 1 Score: 107.8 bits (268), Expect = 4.5e-24 Identity = 50/62 (80.65%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of CsGy6G014610 vs. TAIR10
Match: AT3G05490.1 (ralf-like 22) HSP 1 Score: 105.1 bits (261), Expect = 2.9e-23 Identity = 47/61 (77.05%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of CsGy6G014610 vs. TAIR10
Match: AT2G33775.1 (ralf-like 19) HSP 1 Score: 89.0 bits (219), Expect = 2.2e-18 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 0
BLAST of CsGy6G014610 vs. Swiss-Prot
Match: sp|Q9LUS7|RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana OX=3702 GN=RALF23 PE=1 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 9.3e-27 Identity = 73/134 (54.48%), Postives = 85/134 (63.43%), Query Frame = 0
BLAST of CsGy6G014610 vs. Swiss-Prot
Match: sp|Q8L9P8|RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.6e-26 Identity = 69/109 (63.30%), Postives = 76/109 (69.72%), Query Frame = 0
BLAST of CsGy6G014610 vs. Swiss-Prot
Match: sp|Q945T0|RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.9e-24 Identity = 62/109 (56.88%), Postives = 78/109 (71.56%), Query Frame = 0
BLAST of CsGy6G014610 vs. Swiss-Prot
Match: sp|Q9SRY3|RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 8.1e-23 Identity = 50/62 (80.65%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of CsGy6G014610 vs. Swiss-Prot
Match: sp|Q9MA62|RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.3e-22 Identity = 47/61 (77.05%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of CsGy6G014610 vs. TrEMBL
Match: tr|A0A0A0KBU7|A0A0A0KBU7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194150 PE=4 SV=1) HSP 1 Score: 237.7 bits (605), Expect = 1.4e-59 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 0
BLAST of CsGy6G014610 vs. TrEMBL
Match: tr|A0A1S3C7V8|A0A1S3C7V8_CUCME (protein RALF-like 33 OS=Cucumis melo OX=3656 GN=LOC103497855 PE=4 SV=1) HSP 1 Score: 218.8 bits (556), Expect = 6.6e-54 Identity = 110/119 (92.44%), Postives = 115/119 (96.64%), Query Frame = 0
BLAST of CsGy6G014610 vs. TrEMBL
Match: tr|A0A2P5E484|A0A2P5E484_PARAD (Rapid ALkalinization Factor OS=Parasponia andersonii OX=3476 GN=PanWU01x14_008020 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 3.3e-29 Identity = 73/116 (62.93%), Postives = 87/116 (75.00%), Query Frame = 0
BLAST of CsGy6G014610 vs. TrEMBL
Match: tr|A5BUA5|A5BUA5_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_037723 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.3e-28 Identity = 73/114 (64.04%), Postives = 87/114 (76.32%), Query Frame = 0
BLAST of CsGy6G014610 vs. TrEMBL
Match: tr|F6HDF3|F6HDF3_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_05s0020g01490 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.3e-28 Identity = 73/114 (64.04%), Postives = 87/114 (76.32%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |