Cla97C01G010420 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATACCGATATTACAGCGTCGACCAAGCCAGAGTACCCAGTAATAGATCGGAACCCTCCATTCACTAAAGTCGTCGGCAATTTCGACACTCTCGATTACCTCCGTTTCGTCACCATCACCGGCGTTTCCGTCACCGTCGGTTATCTTTCCGGTATCAATTTCTTTCTTCCTTCTCATTTTCTTTTGTCATCTTCCATTTCGTTGTACATCTGTAAATCTCTTCTCCTGTCTTTGCGTTTTAGGGATTAAGCCCGGGATTAGGGGCCCGTCAATGGTCACCGGTGGTCTAATTGGTCTGATGGGAGGCTTCATGTACGCTTATCAGAACTCGGCGGGTCGGCTTATGGGATTCTTCCCCAATGAAGGCGAGGTAGCTCGTTATAAGAAATAA ATGAATACCGATATTACAGCGTCGACCAAGCCAGAGTACCCAGTAATAGATCGGAACCCTCCATTCACTAAAGTCGTCGGCAATTTCGACACTCTCGATTACCTCCGTTTCGTCACCATCACCGGCGTTTCCGTCACCGTCGGTTATCTTTCCGGGATTAAGCCCGGGATTAGGGGCCCGTCAATGGTCACCGGTGGTCTAATTGGTCTGATGGGAGGCTTCATGTACGCTTATCAGAACTCGGCGGGTCGGCTTATGGGATTCTTCCCCAATGAAGGCGAGGTAGCTCGTTATAAGAAATAA ATGAATACCGATATTACAGCGTCGACCAAGCCAGAGTACCCAGTAATAGATCGGAACCCTCCATTCACTAAAGTCGTCGGCAATTTCGACACTCTCGATTACCTCCGTTTCGTCACCATCACCGGCGTTTCCGTCACCGTCGGTTATCTTTCCGGGATTAAGCCCGGGATTAGGGGCCCGTCAATGGTCACCGGTGGTCTAATTGGTCTGATGGGAGGCTTCATGTACGCTTATCAGAACTCGGCGGGTCGGCTTATGGGATTCTTCCCCAATGAAGGCGAGGTAGCTCGTTATAAGAAATAA MNTDITASTKPEYPVIDRNPPFTKVVGNFDTLDYLRFVTITGVSVTVGYLSGIKPGIRGPSMVTGGLIGLMGGFMYAYQNSAGRLMGFFPNEGEVARYKK
BLAST of Cla97C01G010420 vs. NCBI nr
Match: XP_022142552.1 (NADH-ubiquinone oxidoreductase 20.9 kDa subunit [Momordica charantia] >XP_022925305.1 NADH-ubiquinone oxidoreductase 20.9 kDa subunit-like [Cucurbita moschata] >XP_023001508.1 NADH-ubiquinone oxidoreductase 20.9 kDa subunit-like [Cucurbita maxima] >XP_022966760.1 NADH-ubiquinone oxidoreductase 20.9 kDa subunit-like [Cucurbita maxima] >XP_023541604.1 NADH-ubiquinone oxidoreductase 20.9 kDa subunit-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 205.3 bits (521), Expect = 9.7e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. NCBI nr
Match: XP_022927362.1 (NADH-ubiquinone oxidoreductase 20.9 kDa subunit-like [Cucurbita moschata] >XP_023520383.1 NADH-ubiquinone oxidoreductase 20.9 kDa subunit-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 204.5 bits (519), Expect = 1.7e-49 Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. NCBI nr
Match: XP_008463609.1 (PREDICTED: NADH-ubiquinone oxidoreductase 20.9 kDa subunit [Cucumis melo]) HSP 1 Score: 204.1 bits (518), Expect = 2.2e-49 Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. NCBI nr
Match: KGN65035.1 (hypothetical protein Csa_1G181470 [Cucumis sativus]) HSP 1 Score: 203.8 bits (517), Expect = 2.8e-49 Identity = 98/100 (98.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. NCBI nr
Match: XP_011654950.1 (PREDICTED: NADH-ubiquinone oxidoreductase 20.9 kDa subunit [Cucumis sativus]) HSP 1 Score: 203.8 bits (517), Expect = 2.8e-49 Identity = 98/100 (98.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. TrEMBL
Match: tr|A0A1S3CJL9|A0A1S3CJL9_CUCME (NADH-ubiquinone oxidoreductase 20.9 kDa subunit OS=Cucumis melo OX=3656 GN=LOC103501718 PE=4 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 1.4e-49 Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. TrEMBL
Match: tr|A0A0A0LT27|A0A0A0LT27_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G181470 PE=4 SV=1) HSP 1 Score: 203.8 bits (517), Expect = 1.9e-49 Identity = 98/100 (98.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. TrEMBL
Match: tr|A0A2I0KL30|A0A2I0KL30_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_010416 PE=4 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 7.8e-48 Identity = 96/100 (96.00%), Postives = 97/100 (97.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. TrEMBL
Match: tr|A0A061GID1|A0A061GID1_THECC (NADH-ubiquinone oxidoreductase 21 kDa subunit OS=Theobroma cacao OX=3641 GN=TCM_030394 PE=4 SV=1) HSP 1 Score: 197.2 bits (500), Expect = 1.7e-47 Identity = 94/100 (94.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. TrEMBL
Match: tr|C6SY14|C6SY14_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100819728 PE=2 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 3.0e-47 Identity = 95/100 (95.00%), Postives = 98/100 (98.00%), Query Frame = 0
BLAST of Cla97C01G010420 vs. TAIR10
Match: AT4G16450.1 (unknown protein) HSP 1 Score: 181.8 bits (460), Expect = 2.1e-46 Identity = 87/100 (87.00%), Postives = 93/100 (93.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|