Carg11411 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCGGCCCTGGCGATTGGCTTCAATTTTACCATCAAAATCTTCCTACCACGGCGGCGCCACCGCCTTCCGATCAATCCACCTCCGAGATGATCTTCGCCGATCGAGTTTCCGACGCCATCGCCTCCGCAAACACCGGCGCTTCCACTGGCTTGAATCCGGAACGTCGTGTAGCAAAGCCGGTTCGCCGCCGGTCCAGGACGTCTCGGCGGACTCCGACGACCTTGCTCAATACAGACACAACTAATTTCAGAGCGATGGTTCAACAATTCACCGGCGGTCCAACTCCGCCTTTCGCCTCATCGATTTCCCCCAATTTTTCGTTAGGGTTCGGCGCGATTCCTCAATCGAATTCCGGCTTGATTTCTCCGCCGTCTGGTTATCCACTGCAGTTTTACCATCACAACCCCCAACCGTTCGTGATTCCAGCATCCGCACACGGCGGAGAATTTCTTCAGAGGCTATCCGCCGCGAAGCCAGGTAATGGCGGAATCGCCGCAGACGGATTTCTGATGGAAAGTGCAATTTCTTCTCAAATTCCTCCAGCCGGAGCTTCTGCAGATTCCTCCAACAAGAGCAACGGCGGTAATGGCGGCGGCTTTCTGTTCTGA ATGTCCGGCCCTGGCGATTGGCTTCAATTTTACCATCAAAATCTTCCTACCACGGCGGCGCCACCGCCTTCCGATCAATCCACCTCCGAGATGATCTTCGCCGATCGAGTTTCCGACGCCATCGCCTCCGCAAACACCGGCGCTTCCACTGGCTTGAATCCGGAACGTCGTGTAGCAAAGCCGGTTCGCCGCCGGTCCAGGACGTCTCGGCGGACTCCGACGACCTTGCTCAATACAGACACAACTAATTTCAGAGCGATGGTTCAACAATTCACCGGCGGTCCAACTCCGCCTTTCGCCTCATCGATTTCCCCCAATTTTTCGTTAGGGTTCGGCGCGATTCCTCAATCGAATTCCGGCTTGATTTCTCCGCCGTCTGGTTATCCACTGCAGTTTTACCATCACAACCCCCAACCGTTCGTGATTCCAGCATCCGCACACGGCGGAGAATTTCTTCAGAGGCTATCCGCCGCGAAGCCAGGTAATGGCGGAATCGCCGCAGACGGATTTCTGATGGAAAGTGCAATTTCTTCTCAAATTCCTCCAGCCGGAGCTTCTGCAGATTCCTCCAACAAGAGCAACGGCGGTAATGGCGGCGGCTTTCTGTTCTGA ATGTCCGGCCCTGGCGATTGGCTTCAATTTTACCATCAAAATCTTCCTACCACGGCGGCGCCACCGCCTTCCGATCAATCCACCTCCGAGATGATCTTCGCCGATCGAGTTTCCGACGCCATCGCCTCCGCAAACACCGGCGCTTCCACTGGCTTGAATCCGGAACGTCGTGTAGCAAAGCCGGTTCGCCGCCGGTCCAGGACGTCTCGGCGGACTCCGACGACCTTGCTCAATACAGACACAACTAATTTCAGAGCGATGGTTCAACAATTCACCGGCGGTCCAACTCCGCCTTTCGCCTCATCGATTTCCCCCAATTTTTCGTTAGGGTTCGGCGCGATTCCTCAATCGAATTCCGGCTTGATTTCTCCGCCGTCTGGTTATCCACTGCAGTTTTACCATCACAACCCCCAACCGTTCGTGATTCCAGCATCCGCACACGGCGGAGAATTTCTTCAGAGGCTATCCGCCGCGAAGCCAGGTAATGGCGGAATCGCCGCAGACGGATTTCTGATGGAAAGTGCAATTTCTTCTCAAATTCCTCCAGCCGGAGCTTCTGCAGATTCCTCCAACAAGAGCAACGGCGGTAATGGCGGCGGCTTTCTGTTCTGA MSGPGDWLQFYHQNLPTTAAPPPSDQSTSEMIFADRVSDAIASANTGASTGLNPERRVAKPVRRRSRTSRRTPTTLLNTDTTNFRAMVQQFTGGPTPPFASSISPNFSLGFGAIPQSNSGLISPPSGYPLQFYHHNPQPFVIPASAHGGEFLQRLSAAKPGNGGIAADGFLMESAISSQIPPAGASADSSNKSNGGNGGGFLF
BLAST of Carg11411 vs. NCBI nr
Match: XP_022985096.1 (VQ motif-containing protein 22-like [Cucurbita maxima]) HSP 1 Score: 347.4 bits (890), Expect = 3.2e-92 Identity = 196/203 (96.55%), Postives = 198/203 (97.54%), Query Frame = 0
BLAST of Carg11411 vs. NCBI nr
Match: XP_023552946.1 (VQ motif-containing protein 22-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 344.0 bits (881), Expect = 3.5e-91 Identity = 185/203 (91.13%), Postives = 189/203 (93.10%), Query Frame = 0
BLAST of Carg11411 vs. NCBI nr
Match: XP_022931401.1 (VQ motif-containing protein 22-like [Cucurbita moschata]) HSP 1 Score: 324.3 bits (830), Expect = 2.9e-85 Identity = 178/203 (87.68%), Postives = 182/203 (89.66%), Query Frame = 0
BLAST of Carg11411 vs. NCBI nr
Match: XP_011653250.1 (PREDICTED: VQ motif-containing protein 22-like [Cucumis sativus]) HSP 1 Score: 250.0 bits (637), Expect = 7.0e-63 Identity = 134/200 (67.00%), Postives = 144/200 (72.00%), Query Frame = 0
BLAST of Carg11411 vs. NCBI nr
Match: XP_008451884.1 (PREDICTED: VQ motif-containing protein 22-like [Cucumis melo]) HSP 1 Score: 243.0 bits (619), Expect = 8.5e-61 Identity = 130/194 (67.01%), Postives = 138/194 (71.13%), Query Frame = 0
BLAST of Carg11411 vs. TAIR10
Match: AT4G15120.1 (VQ motif-containing protein) HSP 1 Score: 50.1 bits (118), Expect = 1.9e-06 Identity = 41/55 (74.55%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of Carg11411 vs. TAIR10
Match: AT3G22160.1 (VQ motif-containing protein) HSP 1 Score: 47.4 bits (111), Expect = 1.2e-05 Identity = 36/89 (40.45%), Postives = 46/89 (51.69%), Query Frame = 0
BLAST of Carg11411 vs. TAIR10
Match: AT5G65170.1 (VQ motif-containing protein) HSP 1 Score: 43.5 bits (101), Expect = 1.8e-04 Identity = 24/55 (43.64%), Postives = 30/55 (54.55%), Query Frame = 0
BLAST of Carg11411 vs. TAIR10
Match: AT4G39720.1 (VQ motif-containing protein) HSP 1 Score: 42.4 bits (98), Expect = 4.0e-04 Identity = 19/30 (63.33%), Postives = 24/30 (80.00%), Query Frame = 0
BLAST of Carg11411 vs. Swiss-Prot
Match: sp|Q9LIE6|VQ22_ARATH (VQ motif-containing protein 22 OS=Arabidopsis thaliana OX=3702 GN=VQ22 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 2.2e-04 Identity = 36/89 (40.45%), Postives = 46/89 (51.69%), Query Frame = 0
BLAST of Carg11411 vs. TrEMBL
Match: tr|A0A1S3BTN7|A0A1S3BTN7_CUCME (VQ motif-containing protein 22-like OS=Cucumis melo OX=3656 GN=LOC103493042 PE=4 SV=1) HSP 1 Score: 243.0 bits (619), Expect = 5.6e-61 Identity = 130/194 (67.01%), Postives = 138/194 (71.13%), Query Frame = 0
BLAST of Carg11411 vs. TrEMBL
Match: tr|A0A0A0KV74|A0A0A0KV74_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G056730 PE=4 SV=1) HSP 1 Score: 228.0 bits (580), Expect = 1.9e-56 Identity = 126/197 (63.96%), Postives = 135/197 (68.53%), Query Frame = 0
BLAST of Carg11411 vs. TrEMBL
Match: tr|A0A2I4FG60|A0A2I4FG60_9ROSI (VQ motif-containing protein 22-like OS=Juglans regia OX=51240 GN=LOC108998517 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.0e-25 Identity = 90/217 (41.47%), Postives = 116/217 (53.46%), Query Frame = 0
BLAST of Carg11411 vs. TrEMBL
Match: tr|A0A2I4F9H6|A0A2I4F9H6_9ROSI (VQ motif-containing protein 22-like OS=Juglans regia OX=51240 GN=LOC108996736 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 2.0e-21 Identity = 88/235 (37.45%), Postives = 115/235 (48.94%), Query Frame = 0
BLAST of Carg11411 vs. TrEMBL
Match: tr|A0A061DLC3|A0A061DLC3_THECC (Uncharacterized protein OS=Theobroma cacao OX=3641 GN=TCM_002034 PE=4 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 2.6e-21 Identity = 88/217 (40.55%), Postives = 102/217 (47.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|