Csa1G050230 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAATTCGCATCTTTCCATCCTTTCCTTAAAAACATTTTTGCTTAGCTTCCTAATTCATTTTTTTTAAAAAAATGGTGTCTAAAGTGGAAGAAACACTGAGAAGGAAGTACCAGCAAGTTCATCCGCCGCAGACGGCGGTGGCAGCAGTGGCAGCAGCGGCAACGGCAAAGCAAATCCAATGCAATAAAGCCAAATATCCCAAGTTCAAGAGAAGTAGCTCCAATGTTGAAGAAGATGGCGCCTCTTCCGCCATGCTTTTGCTTGCTTGCATTGCTTTTGCCTCTTAATTTTTAGCCACGGAGCCGTCATTCGAGATTTATGGAGGAGGGATTAGCTGTTGTTCTCTTGACGCCGGTCGTCGGAGGCCACTTCCGGTAGCTAATTATGAGTACATAAATATTAATGGTCGTCGTAGTTTTTCTCTGATTTAGAAGTGATTATTAGATCGATAAGATATATATATTCTTTATTTCTATTTTTATTTTCCCTTAATTCGTTTTTTCTTTTTCGCGTTATTAATTTTGTACTCTTTGAAAATTATTTCTTAGTATAAATATATTTTGTTTTCT ATGGTGTCTAAAGTGGAAGAAACACTGAGAAGGAAGTACCAGCAAGTTCATCCGCCGCAGACGGCGGTGGCAGCAGTGGCAGCAGCGGCAACGGCAAAGCAAATCCAATGCAATAAAGCCAAATATCCCAAGTTCAAGAGAAGTAGCTCCAATGTTGAAGAAGATGGCGCCTCTTCCGCCATGCTTTTGCTTGCTTGCATTGCTTTTGCCTCTTAA ATGGTGTCTAAAGTGGAAGAAACACTGAGAAGGAAGTACCAGCAAGTTCATCCGCCGCAGACGGCGGTGGCAGCAGTGGCAGCAGCGGCAACGGCAAAGCAAATCCAATGCAATAAAGCCAAATATCCCAAGTTCAAGAGAAGTAGCTCCAATGTTGAAGAAGATGGCGCCTCTTCCGCCATGCTTTTGCTTGCTTGCATTGCTTTTGCCTCTTAA MVSKVEETLRRKYQQVHPPQTAVAAVAAAATAKQIQCNKAKYPKFKRSSSNVEEDGASSAMLLLACIAFAS*
BLAST of Csa1G050230 vs. TrEMBL
Match: A0A0A0LTS0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G050230 PE=4 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 2.2e-30 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Csa1G050230 vs. TrEMBL
Match: A0A061FZA4_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_014581 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.8e-11 Identity = 41/68 (60.29%), Postives = 46/68 (67.65%), Query Frame = 1
BLAST of Csa1G050230 vs. TrEMBL
Match: A0A151TE32_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_011552 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.9e-10 Identity = 42/70 (60.00%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Csa1G050230 vs. TrEMBL
Match: I1K083_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_05G0454002 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.9e-10 Identity = 41/70 (58.57%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Csa1G050230 vs. TrEMBL
Match: A0A0B2RRF8_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_016720 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.9e-10 Identity = 41/70 (58.57%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Csa1G050230 vs. TAIR10
Match: AT5G50335.1 (AT5G50335.1 unknown protein) HSP 1 Score: 49.3 bits (116), Expect = 1.2e-06 Identity = 23/35 (65.71%), Postives = 27/35 (77.14%), Query Frame = 1
BLAST of Csa1G050230 vs. NCBI nr
Match: gi|700209288|gb|KGN64384.1| (hypothetical protein Csa_1G050230 [Cucumis sativus]) HSP 1 Score: 139.0 bits (349), Expect = 3.2e-30 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Csa1G050230 vs. NCBI nr
Match: gi|659067431|ref|XP_008439407.1| (PREDICTED: uncharacterized protein LOC103484223 [Cucumis melo]) HSP 1 Score: 126.3 bits (316), Expect = 2.1e-26 Identity = 67/74 (90.54%), Postives = 68/74 (91.89%), Query Frame = 1
BLAST of Csa1G050230 vs. NCBI nr
Match: gi|590669889|ref|XP_007037902.1| (Uncharacterized protein TCM_014581 [Theobroma cacao]) HSP 1 Score: 76.3 bits (186), Expect = 2.5e-11 Identity = 41/68 (60.29%), Postives = 46/68 (67.65%), Query Frame = 1
BLAST of Csa1G050230 vs. NCBI nr
Match: gi|1012354132|gb|KYP65319.1| (hypothetical protein KK1_011552 [Cajanus cajan]) HSP 1 Score: 72.8 bits (177), Expect = 2.8e-10 Identity = 42/70 (60.00%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Csa1G050230 vs. NCBI nr
Match: gi|734407586|gb|KHN34392.1| (hypothetical protein glysoja_016720 [Glycine soja]) HSP 1 Score: 72.8 bits (177), Expect = 2.8e-10 Identity = 41/70 (58.57%), Postives = 47/70 (67.14%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|