MELO3C022853 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTTGATGCCAATGGCGACGGTAAGATCTCTTCGTCCGAGCTTGGGGAAGCCTTGAAGACCCTCGGCTCCGTCACCGCTGACGAAGTACAGCGGATGATGGCTGAGATCGACACCGATGGCGATGGGTTCATTTCATACGAAGAGTTCACAGATTTTGCTCGTGCTAACCGTGGATTAGTCAAGGATGTTGCAAAGATATTCTAA ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTTGATGCCAATGGCGACGGTAAGATCTCTTCGTCCGAGCTTGGGGAAGCCTTGAAGACCCTCGGCTCCGTCACCGCTGACGAAGTACAGCGGATGATGGCTGAGATCGACACCGATGGCGATGGGTTCATTTCATACGAAGAGTTCACAGATTTTGCTCGTGCTAACCGTGGATTAGTCAAGGATGTTGCAAAGATATTCTAA ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTTGATGCCAATGGCGACGGTAAGATCTCTTCGTCCGAGCTTGGGGAAGCCTTGAAGACCCTCGGCTCCGTCACCGCTGACGAAGTACAGCGGATGATGGCTGAGATCGACACCGATGGCGATGGGTTCATTTCATACGAAGAGTTCACAGATTTTGCTCGTGCTAACCGTGGATTAGTCAAGGATGTTGCAAAGATATTCTAA MADDPQDQAERERIFKRFDANGDGKISSSELGEALKTLGSVTADEVQRMMAEIDTDGDGFISYEEFTDFARANRGLVKDVAKIF*
BLAST of MELO3C022853 vs. Swiss-Prot
Match: ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea GN=OLE3 PE=1 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 5.9e-36 Identity = 75/84 (89.29%), Postives = 77/84 (91.67%), Query Frame = 1
BLAST of MELO3C022853 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 5.0e-35 Identity = 73/85 (85.88%), Postives = 79/85 (92.94%), Query Frame = 1
BLAST of MELO3C022853 vs. Swiss-Prot
Match: POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album PE=1 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 8.6e-35 Identity = 72/82 (87.80%), Postives = 76/82 (92.68%), Query Frame = 1
BLAST of MELO3C022853 vs. Swiss-Prot
Match: POLC4_ALNGL (Polcalcin Aln g 4 OS=Alnus glutinosa PE=1 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 2.5e-34 Identity = 74/85 (87.06%), Postives = 78/85 (91.76%), Query Frame = 1
BLAST of MELO3C022853 vs. Swiss-Prot
Match: POLC1_TOBAC (Polcalcin Nic t 1 OS=Nicotiana tabacum GN=Nict1 PE=1 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 4.3e-34 Identity = 69/84 (82.14%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of MELO3C022853 vs. TrEMBL
Match: A0A0A0KQB8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G420320 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.5e-38 Identity = 83/84 (98.81%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of MELO3C022853 vs. TrEMBL
Match: I3ST68_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.0e-34 Identity = 77/84 (91.67%), Postives = 80/84 (95.24%), Query Frame = 1
BLAST of MELO3C022853 vs. TrEMBL
Match: W8PPL7_FRAEX (Fra e 3.01 allergen OS=Fraxinus excelsior PE=2 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 1.7e-34 Identity = 75/84 (89.29%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of MELO3C022853 vs. TrEMBL
Match: A0A151U189_CAJCA (Polcalcin Ole e 3 OS=Cajanus cajan GN=KK1_005654 PE=4 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 8.6e-34 Identity = 74/84 (88.10%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of MELO3C022853 vs. TrEMBL
Match: G7K1Y2_MEDTR (EF hand calcium-binding family protein OS=Medicago truncatula GN=MTR_5g079470 PE=4 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 8.6e-34 Identity = 73/84 (86.90%), Postives = 81/84 (96.43%), Query Frame = 1
BLAST of MELO3C022853 vs. TAIR10
Match: AT5G17480.1 (AT5G17480.1 pollen calcium-binding protein 1) HSP 1 Score: 132.5 bits (332), Expect = 1.2e-31 Identity = 65/81 (80.25%), Postives = 73/81 (90.12%), Query Frame = 1
BLAST of MELO3C022853 vs. TAIR10
Match: AT3G03430.1 (AT3G03430.1 Calcium-binding EF-hand family protein) HSP 1 Score: 128.6 bits (322), Expect = 1.8e-30 Identity = 60/81 (74.07%), Postives = 72/81 (88.89%), Query Frame = 1
BLAST of MELO3C022853 vs. TAIR10
Match: AT1G73630.1 (AT1G73630.1 EF hand calcium-binding protein family) HSP 1 Score: 73.2 bits (178), Expect = 8.9e-14 Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 1
HSP 2 Score: 48.9 bits (115), Expect = 1.8e-06 Identity = 24/58 (41.38%), Postives = 35/58 (60.34%), Query Frame = 1
BLAST of MELO3C022853 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 67.4 bits (163), Expect = 4.9e-12 Identity = 31/60 (51.67%), Postives = 42/60 (70.00%), Query Frame = 1
HSP 2 Score: 47.8 bits (112), Expect = 4.0e-06 Identity = 23/53 (43.40%), Postives = 33/53 (62.26%), Query Frame = 1
BLAST of MELO3C022853 vs. TAIR10
Match: AT3G51920.1 (AT3G51920.1 calmodulin 9) HSP 1 Score: 62.8 bits (151), Expect = 1.2e-10 Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 1
HSP 2 Score: 40.0 bits (92), Expect = 8.3e-04 Identity = 22/69 (31.88%), Postives = 42/69 (60.87%), Query Frame = 1
BLAST of MELO3C022853 vs. NCBI nr
Match: gi|659121144|ref|XP_008460520.1| (PREDICTED: polcalcin Ole e 3 [Cucumis melo]) HSP 1 Score: 167.5 bits (423), Expect = 9.8e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of MELO3C022853 vs. NCBI nr
Match: gi|449445084|ref|XP_004140303.1| (PREDICTED: polcalcin Ole e 3 [Cucumis sativus]) HSP 1 Score: 166.4 bits (420), Expect = 2.2e-38 Identity = 83/84 (98.81%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of MELO3C022853 vs. NCBI nr
Match: gi|388510788|gb|AFK43460.1| (unknown [Lotus japonicus]) HSP 1 Score: 153.7 bits (387), Expect = 1.5e-34 Identity = 77/84 (91.67%), Postives = 80/84 (95.24%), Query Frame = 1
BLAST of MELO3C022853 vs. NCBI nr
Match: gi|589912891|gb|AHL24661.1| (Fra e 3.01 allergen [Fraxinus excelsior]) HSP 1 Score: 152.9 bits (385), Expect = 2.5e-34 Identity = 75/84 (89.29%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of MELO3C022853 vs. NCBI nr
Match: gi|14423844|sp|O81092.1|ALL3_OLEEU (RecName: Full=Polcalcin Ole e 3; AltName: Full=Calcium-binding pollen allergen Ole e 3; AltName: Allergen=Ole e 3) HSP 1 Score: 151.0 bits (380), Expect = 9.5e-34 Identity = 75/84 (89.29%), Postives = 79/84 (94.05%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|