Cla019760 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTCGACGCCAATGGCGACGGTAAGATCTCTGCATCCGAGCTCGGGGAAGCCTTGAAGACGCTCGGCTCCGTCACCGCTGACGAAGTGCAGCGGATGATGGCCGAGATCGACACCGATGGCGACGGGTTCATTTCGTATGAAGAGTTCACAGATTTCGCCCGCGCTAACCGTGGATTAGTCAAGGATGTTGCAAAGATATTCTAA ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTCGACGCCAATGGCGACGGTAAGATCTCTGCATCCGAGCTCGGGGAAGCCTTGAAGACGCTCGGCTCCGTCACCGCTGACGAAGTGCAGCGGATGATGGCCGAGATCGACACCGATGGCGACGGGTTCATTTCGTATGAAGAGTTCACAGATTTCGCCCGCGCTAACCGTGGATTAGTCAAGGATGTTGCAAAGATATTCTAA ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTCGACGCCAATGGCGACGGTAAGATCTCTGCATCCGAGCTCGGGGAAGCCTTGAAGACGCTCGGCTCCGTCACCGCTGACGAAGTGCAGCGGATGATGGCCGAGATCGACACCGATGGCGACGGGTTCATTTCGTATGAAGAGTTCACAGATTTCGCCCGCGCTAACCGTGGATTAGTCAAGGATGTTGCAAAGATATTCTAA MADDPQDQAERERIFKRFDANGDGKISASELGEALKTLGSVTADEVQRMMAEIDTDGDGFISYEEFTDFARANRGLVKDVAKIF
BLAST of Cla019760 vs. Swiss-Prot
Match: ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea GN=OLE3 PE=1 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.3e-35 Identity = 74/84 (88.10%), Postives = 77/84 (91.67%), Query Frame = 1
BLAST of Cla019760 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 2.2e-35 Identity = 74/85 (87.06%), Postives = 79/85 (92.94%), Query Frame = 1
BLAST of Cla019760 vs. Swiss-Prot
Match: POLC4_ALNGL (Polcalcin Aln g 4 OS=Alnus glutinosa PE=1 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.1e-34 Identity = 75/85 (88.24%), Postives = 78/85 (91.76%), Query Frame = 1
BLAST of Cla019760 vs. Swiss-Prot
Match: POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album PE=1 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 1.9e-34 Identity = 71/82 (86.59%), Postives = 76/82 (92.68%), Query Frame = 1
BLAST of Cla019760 vs. Swiss-Prot
Match: POLC1_TOBAC (Polcalcin Nic t 1 OS=Nicotiana tabacum GN=Nict1 PE=1 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 9.4e-34 Identity = 68/84 (80.95%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of Cla019760 vs. TrEMBL
Match: A0A0A0KQB8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G420320 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 3.3e-38 Identity = 82/84 (97.62%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Cla019760 vs. TrEMBL
Match: I3ST68_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.2e-34 Identity = 76/84 (90.48%), Postives = 80/84 (95.24%), Query Frame = 1
BLAST of Cla019760 vs. TrEMBL
Match: W8PPL7_FRAEX (Fra e 3.01 allergen OS=Fraxinus excelsior PE=2 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 3.8e-34 Identity = 74/84 (88.10%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of Cla019760 vs. TrEMBL
Match: G7K1Y2_MEDTR (EF hand calcium-binding family protein OS=Medicago truncatula GN=MTR_5g079470 PE=4 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 1.9e-33 Identity = 72/84 (85.71%), Postives = 81/84 (96.43%), Query Frame = 1
BLAST of Cla019760 vs. TrEMBL
Match: A0A151U189_CAJCA (Polcalcin Ole e 3 OS=Cajanus cajan GN=KK1_005654 PE=4 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 1.9e-33 Identity = 73/84 (86.90%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of Cla019760 vs. NCBI nr
Match: gi|659121144|ref|XP_008460520.1| (PREDICTED: polcalcin Ole e 3 [Cucumis melo]) HSP 1 Score: 166.4 bits (420), Expect = 2.2e-38 Identity = 83/84 (98.81%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Cla019760 vs. NCBI nr
Match: gi|449445084|ref|XP_004140303.1| (PREDICTED: polcalcin Ole e 3 [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 4.8e-38 Identity = 82/84 (97.62%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Cla019760 vs. NCBI nr
Match: gi|388510788|gb|AFK43460.1| (unknown [Lotus japonicus]) HSP 1 Score: 152.5 bits (384), Expect = 3.2e-34 Identity = 76/84 (90.48%), Postives = 80/84 (95.24%), Query Frame = 1
BLAST of Cla019760 vs. NCBI nr
Match: gi|589912891|gb|AHL24661.1| (Fra e 3.01 allergen [Fraxinus excelsior]) HSP 1 Score: 151.8 bits (382), Expect = 5.5e-34 Identity = 74/84 (88.10%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of Cla019760 vs. NCBI nr
Match: gi|2051993|emb|CAA73147.1| (Bet v 4 [Betula pendula]) HSP 1 Score: 150.6 bits (379), Expect = 1.2e-33 Identity = 75/85 (88.24%), Postives = 82/85 (96.47%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|