CmaCh04G022940 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGATGATGCTCAAGACAAAGTTGACCGTGACCGTATTTTCAAGCGTTTTGATACCAATGGCGATGGTAAGATCTCTTCAACCGAGCTCGGGGAATCATTGAAAACACTTGGCTCTGTTACCAACGACGAAGTTCATCGGATGATGGCTGAGATCGATACTGATGGCGACGGGTTCATTTCGTATGAAGAATTCACAAGTTTCGCTCTTGCCAACCGTGGATTAGTCAAGGATGTTGCAAAGATTTTCTAG ATGTCTGATGATGCTCAAGACAAAGTTGACCGTGACCGTATTTTCAAGCGTTTTGATACCAATGGCGATGGTAAGATCTCTTCAACCGAGCTCGGGGAATCATTGAAAACACTTGGCTCTGTTACCAACGACGAAGTTCATCGGATGATGGCTGAGATCGATACTGATGGCGACGGGTTCATTTCGTATGAAGAATTCACAAGTTTCGCTCTTGCCAACCGTGGATTAGTCAAGGATGTTGCAAAGATTTTCTAG ATGTCTGATGATGCTCAAGACAAAGTTGACCGTGACCGTATTTTCAAGCGTTTTGATACCAATGGCGATGGTAAGATCTCTTCAACCGAGCTCGGGGAATCATTGAAAACACTTGGCTCTGTTACCAACGACGAAGTTCATCGGATGATGGCTGAGATCGATACTGATGGCGACGGGTTCATTTCGTATGAAGAATTCACAAGTTTCGCTCTTGCCAACCGTGGATTAGTCAAGGATGTTGCAAAGATTTTCTAG MSDDAQDKVDRDRIFKRFDTNGDGKISSTELGESLKTLGSVTNDEVHRMMAEIDTDGDGFISYEEFTSFALANRGLVKDVAKIF
BLAST of CmaCh04G022940 vs. Swiss-Prot
Match: POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album PE=1 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 5.7e-31 Identity = 67/82 (81.71%), Postives = 74/82 (90.24%), Query Frame = 1
BLAST of CmaCh04G022940 vs. Swiss-Prot
Match: ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea GN=OLE3 PE=1 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 7.4e-31 Identity = 66/84 (78.57%), Postives = 75/84 (89.29%), Query Frame = 1
BLAST of CmaCh04G022940 vs. Swiss-Prot
Match: POLC1_TOBAC (Polcalcin Nic t 1 OS=Nicotiana tabacum GN=Nict1 PE=1 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 2.8e-30 Identity = 64/84 (76.19%), Postives = 73/84 (86.90%), Query Frame = 1
BLAST of CmaCh04G022940 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.1e-29 Identity = 65/85 (76.47%), Postives = 74/85 (87.06%), Query Frame = 1
BLAST of CmaCh04G022940 vs. Swiss-Prot
Match: POLC2_BRACM (Polcalcin Bra r 2 OS=Brassica campestris PE=1 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.2e-28 Identity = 59/81 (72.84%), Postives = 73/81 (90.12%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TrEMBL
Match: A0A0A0KQB8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G420320 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 2.3e-31 Identity = 71/84 (84.52%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TrEMBL
Match: A0A067KMY8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13424 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 5.7e-30 Identity = 68/84 (80.95%), Postives = 75/84 (89.29%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TrEMBL
Match: G7K1Y2_MEDTR (EF hand calcium-binding family protein OS=Medicago truncatula GN=MTR_5g079470 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 9.8e-30 Identity = 68/84 (80.95%), Postives = 74/84 (88.10%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TrEMBL
Match: I3ST68_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 9.8e-30 Identity = 69/84 (82.14%), Postives = 75/84 (89.29%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TrEMBL
Match: A0A0M3TIL4_SALKA (Polcalcin OS=Salsola kali PE=2 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.7e-29 Identity = 67/82 (81.71%), Postives = 75/82 (91.46%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TAIR10
Match: AT5G17480.1 (AT5G17480.1 pollen calcium-binding protein 1) HSP 1 Score: 124.0 bits (310), Expect = 4.3e-29 Identity = 62/81 (76.54%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TAIR10
Match: AT3G03430.1 (AT3G03430.1 Calcium-binding EF-hand family protein) HSP 1 Score: 124.0 bits (310), Expect = 4.3e-29 Identity = 58/81 (71.60%), Postives = 71/81 (87.65%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TAIR10
Match: AT1G73630.1 (AT1G73630.1 EF hand calcium-binding protein family) HSP 1 Score: 65.1 bits (157), Expect = 2.4e-11 Identity = 31/67 (46.27%), Postives = 47/67 (70.15%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 61.6 bits (148), Expect = 2.6e-10 Identity = 29/56 (51.79%), Postives = 41/56 (73.21%), Query Frame = 1
BLAST of CmaCh04G022940 vs. TAIR10
Match: AT3G51920.1 (AT3G51920.1 calmodulin 9) HSP 1 Score: 60.8 bits (146), Expect = 4.5e-10 Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 1
BLAST of CmaCh04G022940 vs. NCBI nr
Match: gi|659121144|ref|XP_008460520.1| (PREDICTED: polcalcin Ole e 3 [Cucumis melo]) HSP 1 Score: 142.9 bits (359), Expect = 2.6e-31 Identity = 71/84 (84.52%), Postives = 77/84 (91.67%), Query Frame = 1
BLAST of CmaCh04G022940 vs. NCBI nr
Match: gi|449445084|ref|XP_004140303.1| (PREDICTED: polcalcin Ole e 3 [Cucumis sativus]) HSP 1 Score: 142.5 bits (358), Expect = 3.3e-31 Identity = 71/84 (84.52%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of CmaCh04G022940 vs. NCBI nr
Match: gi|1009126557|ref|XP_015880220.1| (PREDICTED: polcalcin Bet v 4 [Ziziphus jujuba]) HSP 1 Score: 141.0 bits (354), Expect = 9.7e-31 Identity = 70/84 (83.33%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of CmaCh04G022940 vs. NCBI nr
Match: gi|802634001|ref|XP_012077783.1| (PREDICTED: polcalcin Che a 3-like [Jatropha curcas]) HSP 1 Score: 137.9 bits (346), Expect = 8.2e-30 Identity = 68/84 (80.95%), Postives = 75/84 (89.29%), Query Frame = 1
BLAST of CmaCh04G022940 vs. NCBI nr
Match: gi|357492167|ref|XP_003616372.1| (EF hand calcium-binding family protein [Medicago truncatula]) HSP 1 Score: 137.1 bits (344), Expect = 1.4e-29 Identity = 68/84 (80.95%), Postives = 74/84 (88.10%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|