CmaCh15G007420 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATGATGCTAAAGACAAAGTTGACCGAGACCGAATTTTCAAGCGCTTCGATGCCAATGGTGACGGTAGGATCTCTGCATCGGAGCTCGGTGAATCCTTGAAGACGCTTGGCTCCGTTACCCCTGACGAAGTGCAGCGGATGATGGCCGAGATCGACACCGACGGCGATGGGTACATTTCATACGAAGAGTTCACGGATTTTGCCCGTGCCAACCGTGGTTTAATCAGAGATGTTGCAAAGATATTCTAA ATGGCTGATGATGCTAAAGACAAAGTTGACCGAGACCGAATTTTCAAGCGCTTCGATGCCAATGGTGACGGTAGGATCTCTGCATCGGAGCTCGGTGAATCCTTGAAGACGCTTGGCTCCGTTACCCCTGACGAAGTGCAGCGGATGATGGCCGAGATCGACACCGACGGCGATGGGTACATTTCATACGAAGAGTTCACGGATTTTGCCCGTGCCAACCGTGGTTTAATCAGAGATGTTGCAAAGATATTCTAA ATGGCTGATGATGCTAAAGACAAAGTTGACCGAGACCGAATTTTCAAGCGCTTCGATGCCAATGGTGACGGTAGGATCTCTGCATCGGAGCTCGGTGAATCCTTGAAGACGCTTGGCTCCGTTACCCCTGACGAAGTGCAGCGGATGATGGCCGAGATCGACACCGACGGCGATGGGTACATTTCATACGAAGAGTTCACGGATTTTGCCCGTGCCAACCGTGGTTTAATCAGAGATGTTGCAAAGATATTCTAA MADDAKDKVDRDRIFKRFDANGDGRISASELGESLKTLGSVTPDEVQRMMAEIDTDGDGYISYEEFTDFARANRGLIRDVAKIF
BLAST of CmaCh15G007420 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.4e-32 Identity = 67/85 (78.82%), Postives = 80/85 (94.12%), Query Frame = 1
BLAST of CmaCh15G007420 vs. Swiss-Prot
Match: ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea GN=OLE3 PE=1 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.4e-32 Identity = 66/84 (78.57%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of CmaCh15G007420 vs. Swiss-Prot
Match: POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album PE=1 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.1e-31 Identity = 64/82 (78.05%), Postives = 77/82 (93.90%), Query Frame = 1
BLAST of CmaCh15G007420 vs. Swiss-Prot
Match: POLC4_ALNGL (Polcalcin Aln g 4 OS=Alnus glutinosa PE=1 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 9.7e-31 Identity = 65/85 (76.47%), Postives = 79/85 (92.94%), Query Frame = 1
BLAST of CmaCh15G007420 vs. Swiss-Prot
Match: POLC1_TOBAC (Polcalcin Nic t 1 OS=Nicotiana tabacum GN=Nict1 PE=1 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.3e-30 Identity = 63/84 (75.00%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TrEMBL
Match: A0A0A0KQB8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G420320 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 9.4e-33 Identity = 70/84 (83.33%), Postives = 81/84 (96.43%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TrEMBL
Match: A0A067KMY8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13424 PE=4 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 2.7e-32 Identity = 70/84 (83.33%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TrEMBL
Match: A0A151U189_CAJCA (Polcalcin Ole e 3 OS=Cajanus cajan GN=KK1_005654 PE=4 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 6.1e-32 Identity = 69/84 (82.14%), Postives = 78/84 (92.86%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TrEMBL
Match: W8PPL7_FRAEX (Fra e 3.01 allergen OS=Fraxinus excelsior PE=2 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.0e-31 Identity = 67/84 (79.76%), Postives = 78/84 (92.86%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TrEMBL
Match: A0A0S3RKY3_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.03G092300 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 6.8e-31 Identity = 68/84 (80.95%), Postives = 78/84 (92.86%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TAIR10
Match: AT5G17480.1 (AT5G17480.1 pollen calcium-binding protein 1) HSP 1 Score: 130.2 bits (326), Expect = 6.0e-31 Identity = 63/81 (77.78%), Postives = 74/81 (91.36%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TAIR10
Match: AT3G03430.1 (AT3G03430.1 Calcium-binding EF-hand family protein) HSP 1 Score: 129.4 bits (324), Expect = 1.0e-30 Identity = 60/81 (74.07%), Postives = 74/81 (91.36%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TAIR10
Match: AT1G73630.1 (AT1G73630.1 EF hand calcium-binding protein family) HSP 1 Score: 66.6 bits (161), Expect = 8.2e-12 Identity = 31/66 (46.97%), Postives = 46/66 (69.70%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 63.9 bits (154), Expect = 5.3e-11 Identity = 28/58 (48.28%), Postives = 43/58 (74.14%), Query Frame = 1
BLAST of CmaCh15G007420 vs. TAIR10
Match: AT1G18210.1 (AT1G18210.1 Calcium-binding EF-hand family protein) HSP 1 Score: 63.9 bits (154), Expect = 5.3e-11 Identity = 33/84 (39.29%), Postives = 52/84 (61.90%), Query Frame = 1
BLAST of CmaCh15G007420 vs. NCBI nr
Match: gi|659121144|ref|XP_008460520.1| (PREDICTED: polcalcin Ole e 3 [Cucumis melo]) HSP 1 Score: 148.3 bits (373), Expect = 6.1e-33 Identity = 71/84 (84.52%), Postives = 81/84 (96.43%), Query Frame = 1
BLAST of CmaCh15G007420 vs. NCBI nr
Match: gi|449445084|ref|XP_004140303.1| (PREDICTED: polcalcin Ole e 3 [Cucumis sativus]) HSP 1 Score: 147.1 bits (370), Expect = 1.4e-32 Identity = 70/84 (83.33%), Postives = 81/84 (96.43%), Query Frame = 1
BLAST of CmaCh15G007420 vs. NCBI nr
Match: gi|802634001|ref|XP_012077783.1| (PREDICTED: polcalcin Che a 3-like [Jatropha curcas]) HSP 1 Score: 145.6 bits (366), Expect = 3.9e-32 Identity = 70/84 (83.33%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of CmaCh15G007420 vs. NCBI nr
Match: gi|1012361862|gb|KYP73045.1| (Polcalcin Ole e 3 [Cajanus cajan]) HSP 1 Score: 144.4 bits (363), Expect = 8.8e-32 Identity = 69/84 (82.14%), Postives = 78/84 (92.86%), Query Frame = 1
BLAST of CmaCh15G007420 vs. NCBI nr
Match: gi|950990396|ref|XP_014504310.1| (PREDICTED: polcalcin Ole e 3 [Vigna radiata var. radiata]) HSP 1 Score: 144.1 bits (362), Expect = 1.1e-31 Identity = 69/84 (82.14%), Postives = 79/84 (94.05%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|