Cucsa.006310 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTTGACGCCAATGGCGACGGTAAGATCTCTTCCGCTGAGCTTGGGGAAGCCTTGAAGACCCTCGGCTCCGTCACCGCCGACGAAGTACAACGGATGATGGCTGAGATCGACACTGACGGTGATGGCTTCATTTCCTACGAAGAGTTCACAGATTTCGCTCGTGCTAACCGTGGATTAGTCAAGGAT ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTTGACGCCAATGGCGACGGTAAGATCTCTTCCGCTGAGCTTGGGGAAGCCTTGAAGACCCTCGGCTCCGTCACCGCCGACGAAGTACAACGGATGATGGCTGAGATCGACACTGACGGTGATGGCTTCATTTCCTACGAAGAGTTCACAGATTTCGCTCGTGCTAACCGTGGATTAGTCAAGGAT ATGGCTGATGATCCTCAAGACCAAGCTGAACGTGAACGCATTTTCAAGCGCTTTGACGCCAATGGCGACGGTAAGATCTCTTCCGCTGAGCTTGGGGAAGCCTTGAAGACCCTCGGCTCCGTCACCGCCGACGAAGTACAACGGATGATGGCTGAGATCGACACTGACGGTGATGGCTTCATTTCCTACGAAGAGTTCACAGATTTCGCTCGTGCTAACCGTGGATTAGTCAAGGAT MADDPQDQAERERIFKRFDANGDGKISSAELGEALKTLGSVTADEVQRMMAEIDTDGDGFISYEEFTDFARANRGLVKD
BLAST of Cucsa.006310 vs. Swiss-Prot
Match: ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea GN=OLE3 PE=1 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 5.7e-33 Identity = 69/79 (87.34%), Postives = 74/79 (93.67%), Query Frame = 1
BLAST of Cucsa.006310 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 9.7e-33 Identity = 69/80 (86.25%), Postives = 76/80 (95.00%), Query Frame = 1
BLAST of Cucsa.006310 vs. Swiss-Prot
Match: POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album PE=1 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 3.7e-32 Identity = 67/77 (87.01%), Postives = 73/77 (94.81%), Query Frame = 1
BLAST of Cucsa.006310 vs. Swiss-Prot
Match: POLC1_TOBAC (Polcalcin Nic t 1 OS=Nicotiana tabacum GN=Nict1 PE=1 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 6.3e-32 Identity = 66/79 (83.54%), Postives = 73/79 (92.41%), Query Frame = 1
BLAST of Cucsa.006310 vs. Swiss-Prot
Match: POLC4_ALNGL (Polcalcin Aln g 4 OS=Alnus glutinosa PE=1 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 2.4e-31 Identity = 68/80 (85.00%), Postives = 75/80 (93.75%), Query Frame = 1
BLAST of Cucsa.006310 vs. TrEMBL
Match: A0A0A0KQB8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G420320 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 2.9e-36 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1
BLAST of Cucsa.006310 vs. TrEMBL
Match: I3ST68_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 9.8e-32 Identity = 71/79 (89.87%), Postives = 75/79 (94.94%), Query Frame = 1
BLAST of Cucsa.006310 vs. TrEMBL
Match: W8PPL7_FRAEX (Fra e 3.01 allergen OS=Fraxinus excelsior PE=2 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 1.7e-31 Identity = 69/79 (87.34%), Postives = 74/79 (93.67%), Query Frame = 1
BLAST of Cucsa.006310 vs. TrEMBL
Match: A0A151U189_CAJCA (Polcalcin Ole e 3 OS=Cajanus cajan GN=KK1_005654 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 1.7e-31 Identity = 70/79 (88.61%), Postives = 74/79 (93.67%), Query Frame = 1
BLAST of Cucsa.006310 vs. TrEMBL
Match: G7K1Y2_MEDTR (EF hand calcium-binding family protein OS=Medicago truncatula GN=MTR_5g079470 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 1.7e-31 Identity = 69/79 (87.34%), Postives = 76/79 (96.20%), Query Frame = 1
BLAST of Cucsa.006310 vs. TAIR10
Match: AT5G17480.1 (AT5G17480.1 pollen calcium-binding protein 1) HSP 1 Score: 124.8 bits (312), Expect = 2.4e-29 Identity = 61/76 (80.26%), Postives = 70/76 (92.11%), Query Frame = 1
BLAST of Cucsa.006310 vs. TAIR10
Match: AT3G03430.1 (AT3G03430.1 Calcium-binding EF-hand family protein) HSP 1 Score: 120.9 bits (302), Expect = 3.4e-28 Identity = 56/76 (73.68%), Postives = 69/76 (90.79%), Query Frame = 1
BLAST of Cucsa.006310 vs. TAIR10
Match: AT1G73630.1 (AT1G73630.1 EF hand calcium-binding protein family) HSP 1 Score: 72.0 bits (175), Expect = 1.8e-13 Identity = 35/75 (46.67%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of Cucsa.006310 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 67.0 bits (162), Expect = 5.9e-12 Identity = 31/60 (51.67%), Postives = 44/60 (73.33%), Query Frame = 1
HSP 2 Score: 47.4 bits (111), Expect = 4.8e-06 Identity = 23/53 (43.40%), Postives = 35/53 (66.04%), Query Frame = 1
BLAST of Cucsa.006310 vs. TAIR10
Match: AT1G18210.1 (AT1G18210.1 Calcium-binding EF-hand family protein) HSP 1 Score: 65.9 bits (159), Expect = 1.3e-11 Identity = 31/71 (43.66%), Postives = 48/71 (67.61%), Query Frame = 1
BLAST of Cucsa.006310 vs. NCBI nr
Match: gi|449445084|ref|XP_004140303.1| (PREDICTED: polcalcin Ole e 3 [Cucumis sativus]) HSP 1 Score: 158.7 bits (400), Expect = 4.2e-36 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1
BLAST of Cucsa.006310 vs. NCBI nr
Match: gi|659121144|ref|XP_008460520.1| (PREDICTED: polcalcin Ole e 3 [Cucumis melo]) HSP 1 Score: 157.5 bits (397), Expect = 9.4e-36 Identity = 78/79 (98.73%), Postives = 79/79 (100.00%), Query Frame = 1
BLAST of Cucsa.006310 vs. NCBI nr
Match: gi|388510788|gb|AFK43460.1| (unknown [Lotus japonicus]) HSP 1 Score: 143.7 bits (361), Expect = 1.4e-31 Identity = 71/79 (89.87%), Postives = 75/79 (94.94%), Query Frame = 1
BLAST of Cucsa.006310 vs. NCBI nr
Match: gi|589912891|gb|AHL24661.1| (Fra e 3.01 allergen [Fraxinus excelsior]) HSP 1 Score: 142.9 bits (359), Expect = 2.4e-31 Identity = 69/79 (87.34%), Postives = 74/79 (93.67%), Query Frame = 1
BLAST of Cucsa.006310 vs. NCBI nr
Match: gi|1012361862|gb|KYP73045.1| (Polcalcin Ole e 3 [Cajanus cajan]) HSP 1 Score: 142.9 bits (359), Expect = 2.4e-31 Identity = 70/79 (88.61%), Postives = 74/79 (93.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|