Cp4.1LG12g05450 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGCCAAGCTTTCTGTTCTCCTTCCATTTTGCTTCATCGCTGCATTCCTGATCGTCTTCTCCACTGCAGTATTGGCCACCACCACAAAAGGCCCGAGTTGGGTCCTCGATCGAGCTCTAGCTACCTGTCATGGCTCCATGGCAGACTGCATGATGGATGACATTGAATTTCAGATGGACTCCGAAATCAATAGACGCATATTGGCCGATGTAAACTACATAAGCTACGATGCGCTCAGGGCCAACAAGGTGCCATGCTCACGCAGAGGAGCATCTTACTACAATTGCCAGCCAGGTGCTGAGGCTAACCCCTACGACCGTGGCTGCAGTGCTATTGCTCGTTGCCGAAGCTAA ATGGTGGCCAAGCTTTCTGTTCTCCTTCCATTTTGCTTCATCGCTGCATTCCTGATCGTCTTCTCCACTGCAGTATTGGCCACCACCACAAAAGGCCCGAGTTGGGTCCTCGATCGAGCTCTAGCTACCTGTCATGGCTCCATGGCAGACTGCATGATGGATGACATTGAATTTCAGATGGACTCCGAAATCAATAGACGCATATTGGCCGATGTAAACTACATAAGCTACGATGCGCTCAGGGCCAACAAGGTGCCATGCTCACGCAGAGGAGCATCTTACTACAATTGCCAGCCAGGTGCTGAGGCTAACCCCTACGACCGTGGCTGCAGTGCTATTGCTCGTTGCCGAAGCTAA ATGGTGGCCAAGCTTTCTGTTCTCCTTCCATTTTGCTTCATCGCTGCATTCCTGATCGTCTTCTCCACTGCAGTATTGGCCACCACCACAAAAGGCCCGAGTTGGGTCCTCGATCGAGCTCTAGCTACCTGTCATGGCTCCATGGCAGACTGCATGATGGATGACATTGAATTTCAGATGGACTCCGAAATCAATAGACGCATATTGGCCGATGTAAACTACATAAGCTACGATGCGCTCAGGGCCAACAAGGTGCCATGCTCACGCAGAGGAGCATCTTACTACAATTGCCAGCCAGGTGCTGAGGCTAACCCCTACGACCGTGGCTGCAGTGCTATTGCTCGTTGCCGAAGCTAA MVAKLSVLLPFCFIAAFLIVFSTAVLATTTKGPSWVLDRALATCHGSMADCMMDDIEFQMDSEINRRILADVNYISYDALRANKVPCSRRGASYYNCQPGAEANPYDRGCSAIARCRS
BLAST of Cp4.1LG12g05450 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 5.0e-25 Identity = 62/114 (54.39%), Postives = 77/114 (67.54%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 6.5e-25 Identity = 54/75 (72.00%), Postives = 62/75 (82.67%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 5.5e-24 Identity = 61/111 (54.95%), Postives = 76/111 (68.47%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 7.2e-24 Identity = 58/109 (53.21%), Postives = 73/109 (66.97%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.2e-22 Identity = 52/90 (57.78%), Postives = 60/90 (66.67%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TrEMBL
Match: A0A0A0K607_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G396340 PE=4 SV=1) HSP 1 Score: 172.9 bits (437), Expect = 2.3e-40 Identity = 87/118 (73.73%), Postives = 96/118 (81.36%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TrEMBL
Match: M5VTQ6_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa020353mg PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.9e-27 Identity = 68/103 (66.02%), Postives = 78/103 (75.73%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TrEMBL
Match: B9T0V9_RICCO (RALFL33, putative OS=Ricinus communis GN=RCOM_1439830 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.9e-27 Identity = 67/111 (60.36%), Postives = 80/111 (72.07%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TrEMBL
Match: A2Q327_MEDTR (RALF OS=Medicago truncatula GN=MTR_7g113080 PE=2 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.9e-26 Identity = 59/88 (67.05%), Postives = 67/88 (76.14%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TrEMBL
Match: B9I9T7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0014s12630g PE=4 SV=2) HSP 1 Score: 126.7 bits (317), Expect = 1.9e-26 Identity = 66/101 (65.35%), Postives = 77/101 (76.24%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 114.8 bits (286), Expect = 3.7e-26 Identity = 54/75 (72.00%), Postives = 62/75 (82.67%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 111.7 bits (278), Expect = 3.1e-25 Identity = 61/111 (54.95%), Postives = 76/111 (68.47%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 111.3 bits (277), Expect = 4.1e-25 Identity = 58/109 (53.21%), Postives = 73/109 (66.97%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 105.1 bits (261), Expect = 2.9e-23 Identity = 52/90 (57.78%), Postives = 60/90 (66.67%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. TAIR10
Match: AT1G28270.1 (AT1G28270.1 ralf-like 4) HSP 1 Score: 80.9 bits (198), Expect = 5.9e-16 Identity = 45/100 (45.00%), Postives = 56/100 (56.00%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. NCBI nr
Match: gi|778730402|ref|XP_011659776.1| (PREDICTED: rapid alkalinization factor [Cucumis sativus]) HSP 1 Score: 172.9 bits (437), Expect = 3.2e-40 Identity = 87/118 (73.73%), Postives = 96/118 (81.36%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. NCBI nr
Match: gi|659101540|ref|XP_008451660.1| (PREDICTED: rapid alkalinization factor-like [Cucumis melo]) HSP 1 Score: 169.1 bits (427), Expect = 4.7e-39 Identity = 86/118 (72.88%), Postives = 95/118 (80.51%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. NCBI nr
Match: gi|645258777|ref|XP_008235043.1| (PREDICTED: protein RALF-like 33 [Prunus mume]) HSP 1 Score: 131.0 bits (328), Expect = 1.4e-27 Identity = 71/111 (63.96%), Postives = 80/111 (72.07%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. NCBI nr
Match: gi|595790681|ref|XP_007199089.1| (hypothetical protein PRUPE_ppa020353mg [Prunus persica]) HSP 1 Score: 129.4 bits (324), Expect = 4.1e-27 Identity = 68/103 (66.02%), Postives = 78/103 (75.73%), Query Frame = 1
BLAST of Cp4.1LG12g05450 vs. NCBI nr
Match: gi|255582168|ref|XP_002531878.1| (PREDICTED: protein RALF-like 33 [Ricinus communis]) HSP 1 Score: 129.4 bits (324), Expect = 4.1e-27 Identity = 67/111 (60.36%), Postives = 80/111 (72.07%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|