Cucsa.205730 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GAAGAGCAAGAGAGAAAGTAACAATGGCCACCACGGTTTCTTTTCTTCTTCCAATTTTCTTACTAGTTGCTATCCTGACGGTCTCCTCCACCGCCAAGACACCAAGCTGGGTCCTAGATGGAGCTCATGCTCGTTGTCACGGATCCATGGCAGAGTGCATGATGGAAGATATCGAGTTTCAGATGGACTCTGAGATCAACAGACGCATATTGGCAGATTTAAACTACATAAGCTATGACGCACTCAAGGCCAACTCAGTGCCATGCTCACGCAAAGGAGCATCTTACTACAACTGTCAGCCAGGTGCCGAGGCAAACCCCTATGACCGTGGCTGTAATGCTATTTCTCGTTGTCGAAGCTAA GAAGAGCAAGAGAGAAAGTAACAATGGCCACCACGGTTTCTTTTCTTCTTCCAATTTTCTTACTAGTTGCTATCCTGACGGTCTCCTCCACCGCCAAGACACCAAGCTGGGTCCTAGATGGAGCTCATGCTCGTTGTCACGGATCCATGGCAGAGTGCATGATGGAAGATATCGAGTTTCAGATGGACTCTGAGATCAACAGACGCATATTGGCAGATTTAAACTACATAAGCTATGACGCACTCAAGGCCAACTCAGTGCCATGCTCACGCAAAGGAGCATCTTACTACAACTGTCAGCCAGGTGCCGAGGCAAACCCCTATGACCGTGGCTGTAATGCTATTTCTCGTTGTCGAAGCTAA GAAGAGCAAGAGAGAAAGTAACAATGGCCACCACGGTTTCTTTTCTTCTTCCAATTTTCTTACTAGTTGCTATCCTGACGGTCTCCTCCACCGCCAAGACACCAAGCTGGGTCCTAGATGGAGCTCATGCTCGTTGTCACGGATCCATGGCAGAGTGCATGATGGAAGATATCGAGTTTCAGATGGACTCTGAGATCAACAGACGCATATTGGCAGATTTAAACTACATAAGCTATGACGCACTCAAGGCCAACTCAGTGCCATGCTCACGCAAAGGAGCATCTTACTACAACTGTCAGCCAGGTGCCGAGGCAAACCCCTATGACCGTGGCTGTAATGCTATTTCTCGTTGTCGAAGCTAA RAREKVTMATTVSFLLPIFLLVAILTVSSTAKTPSWVLDGAHARCHGSMAECMMEDIEFQMDSEINRRILADLNYISYDALKANSVPCSRKGASYYNCQPGAEANPYDRGCNAISRCRS*
BLAST of Cucsa.205730 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 9.3e-27 Identity = 60/109 (55.05%), Postives = 77/109 (70.64%), Query Frame = 1
BLAST of Cucsa.205730 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.7e-26 Identity = 58/108 (53.70%), Postives = 79/108 (73.15%), Query Frame = 1
BLAST of Cucsa.205730 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 7.9e-26 Identity = 62/115 (53.91%), Postives = 76/115 (66.09%), Query Frame = 1
BLAST of Cucsa.205730 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.3e-24 Identity = 49/74 (66.22%), Postives = 61/74 (82.43%), Query Frame = 1
BLAST of Cucsa.205730 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.1e-22 Identity = 56/124 (45.16%), Postives = 73/124 (58.87%), Query Frame = 1
BLAST of Cucsa.205730 vs. TrEMBL
Match: A0A0A0K607_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G396340 PE=4 SV=1) HSP 1 Score: 231.9 bits (590), Expect = 4.2e-58 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
BLAST of Cucsa.205730 vs. TrEMBL
Match: V4U5R6_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10023750mg PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 2.6e-28 Identity = 70/119 (58.82%), Postives = 86/119 (72.27%), Query Frame = 1
BLAST of Cucsa.205730 vs. TrEMBL
Match: A0A067H8J5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g033577mg PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 2.6e-28 Identity = 70/119 (58.82%), Postives = 86/119 (72.27%), Query Frame = 1
BLAST of Cucsa.205730 vs. TrEMBL
Match: A0A0A0KWI2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G001640 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 3.4e-28 Identity = 64/110 (58.18%), Postives = 85/110 (77.27%), Query Frame = 1
BLAST of Cucsa.205730 vs. TrEMBL
Match: A0A0D2TE37_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G129000 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.5e-28 Identity = 71/118 (60.17%), Postives = 85/118 (72.03%), Query Frame = 1
BLAST of Cucsa.205730 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 119.4 bits (298), Expect = 1.5e-27 Identity = 58/108 (53.70%), Postives = 79/108 (73.15%), Query Frame = 1
BLAST of Cucsa.205730 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 117.9 bits (294), Expect = 4.4e-27 Identity = 62/115 (53.91%), Postives = 76/115 (66.09%), Query Frame = 1
BLAST of Cucsa.205730 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 112.5 bits (280), Expect = 1.9e-25 Identity = 49/74 (66.22%), Postives = 61/74 (82.43%), Query Frame = 1
BLAST of Cucsa.205730 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 105.9 bits (263), Expect = 1.7e-23 Identity = 56/124 (45.16%), Postives = 73/124 (58.87%), Query Frame = 1
BLAST of Cucsa.205730 vs. TAIR10
Match: AT2G33775.1 (AT2G33775.1 ralf-like 19) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-16 Identity = 46/107 (42.99%), Postives = 68/107 (63.55%), Query Frame = 1
BLAST of Cucsa.205730 vs. NCBI nr
Match: gi|778730402|ref|XP_011659776.1| (PREDICTED: rapid alkalinization factor [Cucumis sativus]) HSP 1 Score: 231.9 bits (590), Expect = 6.0e-58 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
BLAST of Cucsa.205730 vs. NCBI nr
Match: gi|659101540|ref|XP_008451660.1| (PREDICTED: rapid alkalinization factor-like [Cucumis melo]) HSP 1 Score: 218.0 bits (554), Expect = 8.9e-54 Identity = 105/112 (93.75%), Postives = 107/112 (95.54%), Query Frame = 1
BLAST of Cucsa.205730 vs. NCBI nr
Match: gi|567903596|ref|XP_006444286.1| (hypothetical protein CICLE_v10023750mg [Citrus clementina]) HSP 1 Score: 132.9 bits (333), Expect = 3.8e-28 Identity = 70/119 (58.82%), Postives = 86/119 (72.27%), Query Frame = 1
BLAST of Cucsa.205730 vs. NCBI nr
Match: gi|700197639|gb|KGN52797.1| (hypothetical protein Csa_4G001640 [Cucumis sativus]) HSP 1 Score: 132.5 bits (332), Expect = 4.9e-28 Identity = 64/110 (58.18%), Postives = 85/110 (77.27%), Query Frame = 1
BLAST of Cucsa.205730 vs. NCBI nr
Match: gi|823188148|ref|XP_012490418.1| (PREDICTED: protein RALF-like 33 [Gossypium raimondii]) HSP 1 Score: 132.1 bits (331), Expect = 6.4e-28 Identity = 71/118 (60.17%), Postives = 85/118 (72.03%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|