Carg11125 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCAACTCTTCTTCTCCACCTGCCTTCTTCTCTATGCTCATTTTCACCTTAGCCTTCTTTGTCTCTTCGTCCTCTTTAATGGTCGTGGCCATGAGTGGTGACCGTAGTCTTAGCTGGCTCTCGACTGAACCTCGATGCCATGGACGTTCGTTAAGTGAATGCATGATGAATGTTGAGCTTGAAATGGATTCTGAGATCAATCGTCGTATCTTAGCCACTTCAAGTTACATAAGTTACAAGTCGTTGAAGGCGAACAACATTCCATGCTCTCGACGAGGTTCGTCCTACTACAATTGCCAGCCCGGGGCTGAAGCTAACCCCTATCAGCGGGGTTGTACTGTCATTACTCGTTGCAGAAGCTAA ATGGGCAACTCTTCTTCTCCACCTGCCTTCTTCTCTATGCTCATTTTCACCTTAGCCTTCTTTGTCTCTTCGTCCTCTTTAATGGTCGTGGCCATGAGTGGTGACCGTAGTCTTAGCTGGCTCTCGACTGAACCTCGATGCCATGGACGTTCGTTAAGTGAATGCATGATGAATGTTGAGCTTGAAATGGATTCTGAGATCAATCGTCGTATCTTAGCCACTTCAAGTTACATAAGTTACAAGTCGTTGAAGGCGAACAACATTCCATGCTCTCGACGAGGTTCGTCCTACTACAATTGCCAGCCCGGGGCTGAAGCTAACCCCTATCAGCGGGGTTGTACTGTCATTACTCGTTGCAGAAGCTAA ATGGGCAACTCTTCTTCTCCACCTGCCTTCTTCTCTATGCTCATTTTCACCTTAGCCTTCTTTGTCTCTTCGTCCTCTTTAATGGTCGTGGCCATGAGTGGTGACCGTAGTCTTAGCTGGCTCTCGACTGAACCTCGATGCCATGGACGTTCGTTAAGTGAATGCATGATGAATGTTGAGCTTGAAATGGATTCTGAGATCAATCGTCGTATCTTAGCCACTTCAAGTTACATAAGTTACAAGTCGTTGAAGGCGAACAACATTCCATGCTCTCGACGAGGTTCGTCCTACTACAATTGCCAGCCCGGGGCTGAAGCTAACCCCTATCAGCGGGGTTGTACTGTCATTACTCGTTGCAGAAGCTAA MGNSSSPPAFFSMLIFTLAFFVSSSSLMVVAMSGDRSLSWLSTEPRCHGRSLSECMMNVELEMDSEINRRILATSSYISYKSLKANNIPCSRRGSSYYNCQPGAEANPYQRGCTVITRCRS
BLAST of Carg11125 vs. NCBI nr
Match: XP_022934551.1 (protein RALF-like 1 [Cucurbita moschata]) HSP 1 Score: 204.9 bits (520), Expect = 1.5e-49 Identity = 118/121 (97.52%), Postives = 119/121 (98.35%), Query Frame = 0
BLAST of Carg11125 vs. NCBI nr
Match: XP_023529110.1 (protein RALF-like 33 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 203.8 bits (517), Expect = 3.4e-49 Identity = 101/121 (83.47%), Postives = 102/121 (84.30%), Query Frame = 0
BLAST of Carg11125 vs. NCBI nr
Match: XP_022983404.1 (protein RALF-like 1 [Cucurbita maxima]) HSP 1 Score: 203.4 bits (516), Expect = 4.5e-49 Identity = 101/121 (83.47%), Postives = 102/121 (84.30%), Query Frame = 0
BLAST of Carg11125 vs. NCBI nr
Match: KGN52797.1 (hypothetical protein Csa_4G001640 [Cucumis sativus]) HSP 1 Score: 171.4 bits (433), Expect = 1.9e-39 Identity = 79/87 (90.80%), Postives = 84/87 (96.55%), Query Frame = 0
BLAST of Carg11125 vs. NCBI nr
Match: XP_022846470.1 (protein RALF-like 33 [Olea europaea var. sylvestris]) HSP 1 Score: 133.3 bits (334), Expect = 5.7e-28 Identity = 59/95 (62.11%), Postives = 77/95 (81.05%), Query Frame = 0
BLAST of Carg11125 vs. TAIR10
Match: AT1G02900.1 (rapid alkalinization factor 1) HSP 1 Score: 115.5 bits (288), Expect = 2.2e-26 Identity = 56/87 (64.37%), Postives = 69/87 (79.31%), Query Frame = 0
BLAST of Carg11125 vs. TAIR10
Match: AT4G15800.1 (ralf-like 33) HSP 1 Score: 110.9 bits (276), Expect = 5.5e-25 Identity = 52/96 (54.17%), Postives = 72/96 (75.00%), Query Frame = 0
BLAST of Carg11125 vs. TAIR10
Match: AT3G16570.1 (rapid alkalinization factor 23) HSP 1 Score: 102.4 bits (254), Expect = 1.9e-22 Identity = 47/64 (73.44%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of Carg11125 vs. TAIR10
Match: AT3G05490.1 (ralf-like 22) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-21 Identity = 46/75 (61.33%), Postives = 60/75 (80.00%), Query Frame = 0
BLAST of Carg11125 vs. TAIR10
Match: AT2G33775.1 (ralf-like 19) HSP 1 Score: 82.4 bits (202), Expect = 2.1e-16 Identity = 46/94 (48.94%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of Carg11125 vs. Swiss-Prot
Match: sp|Q9SRY3|RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.0e-25 Identity = 56/87 (64.37%), Postives = 69/87 (79.31%), Query Frame = 0
BLAST of Carg11125 vs. Swiss-Prot
Match: sp|Q8L9P8|RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 9.8e-24 Identity = 52/96 (54.17%), Postives = 72/96 (75.00%), Query Frame = 0
BLAST of Carg11125 vs. Swiss-Prot
Match: sp|Q945T0|RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.2e-22 Identity = 50/76 (65.79%), Postives = 61/76 (80.26%), Query Frame = 0
BLAST of Carg11125 vs. Swiss-Prot
Match: sp|Q9LUS7|RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana OX=3702 GN=RALF23 PE=1 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.5e-21 Identity = 47/64 (73.44%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of Carg11125 vs. Swiss-Prot
Match: sp|Q9MA62|RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.9e-20 Identity = 46/75 (61.33%), Postives = 60/75 (80.00%), Query Frame = 0
BLAST of Carg11125 vs. TrEMBL
Match: tr|A0A0A0KWI2|A0A0A0KWI2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G001640 PE=4 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 1.2e-39 Identity = 79/87 (90.80%), Postives = 84/87 (96.55%), Query Frame = 0
BLAST of Carg11125 vs. TrEMBL
Match: tr|A0A200QWN9|A0A200QWN9_9MAGN (Rapid ALkalinization Factor OS=Macleaya cordata OX=56857 GN=BVC80_8955g28 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 3.5e-26 Identity = 60/99 (60.61%), Postives = 73/99 (73.74%), Query Frame = 0
BLAST of Carg11125 vs. TrEMBL
Match: tr|A0A1R3IW04|A0A1R3IW04_COCAP (Rapid ALkalinization Factor OS=Corchorus capsularis OX=210143 GN=CCACVL1_09503 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 6.0e-26 Identity = 60/94 (63.83%), Postives = 74/94 (78.72%), Query Frame = 0
BLAST of Carg11125 vs. TrEMBL
Match: tr|A0A1R3K856|A0A1R3K856_9ROSI (Rapid ALkalinization Factor OS=Corchorus olitorius OX=93759 GN=COLO4_10515 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 6.0e-26 Identity = 60/94 (63.83%), Postives = 74/94 (78.72%), Query Frame = 0
BLAST of Carg11125 vs. TrEMBL
Match: tr|B9T0V9|B9T0V9_RICCO (RALFL33, putative OS=Ricinus communis OX=3988 GN=RCOM_1439830 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 1.0e-25 Identity = 57/87 (65.52%), Postives = 70/87 (80.46%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|