Cla97C05G092700 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTCCGGCGGTTACCAAAGGATACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCCAACGATGCCAAATCCCTAGAAGAACTCTTCCACAGAGCTTATAACCACTCCGTTTGGGTTCTGAACAAGGTTTAACTCTTAATTCTCTAATCTTTCAGTTTTGGAATTGTTTTTTTTTTTTTTTTTCTCTCGATTTGTGGATCCGTTTTGAGGGTTGTGGTGATTGGCAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAATTAA ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTCCGGCGGTTACCAAAGGATACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCCAACGATGCCAAATCCCTAGAAGAACTCTTCCACAGAGCTTATAACCACTCCGTTTGGGTTCTGAACAAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAATTAA ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTCCGGCGGTTACCAAAGGATACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCCAACGATGCCAAATCCCTAGAAGAACTCTTCCACAGAGCTTATAACCACTCCGTTTGGGTTCTGAACAAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAATTAA MEKALRIYGEVLRLVRRLPKDTRPYYAKYARENFVNYREVDANDAKSLEELFHRAYNHSVWVLNKYSVDGSAADKLKEICYN
BLAST of Cla97C05G092700 vs. NCBI nr
Match: XP_008456173.1 (PREDICTED: LYR motif-containing protein At3g19508 [Cucumis melo]) HSP 1 Score: 167.5 bits (423), Expect = 1.8e-38 Identity = 79/82 (96.34%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of Cla97C05G092700 vs. NCBI nr
Match: XP_004140718.1 (PREDICTED: LYR motif-containing protein At3g19508 [Cucumis sativus] >KGN57494.1 hypothetical protein Csa_3G199560 [Cucumis sativus]) HSP 1 Score: 161.8 bits (408), Expect = 1.0e-36 Identity = 76/81 (93.83%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cla97C05G092700 vs. NCBI nr
Match: XP_015892821.1 (LYR motif-containing protein At3g19508 [Ziziphus jujuba]) HSP 1 Score: 161.4 bits (407), Expect = 1.3e-36 Identity = 75/82 (91.46%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of Cla97C05G092700 vs. NCBI nr
Match: XP_022941949.1 (LYR motif-containing protein At3g19508 [Cucurbita moschata] >XP_023512988.1 LYR motif-containing protein At3g19508 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 160.2 bits (404), Expect = 2.9e-36 Identity = 77/80 (96.25%), Postives = 79/80 (98.75%), Query Frame = 0
BLAST of Cla97C05G092700 vs. NCBI nr
Match: XP_022149201.1 (LYR motif-containing protein At3g19508 [Momordica charantia]) HSP 1 Score: 157.5 bits (397), Expect = 1.9e-35 Identity = 75/81 (92.59%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cla97C05G092700 vs. TrEMBL
Match: tr|A0A1S3C3W4|A0A1S3C3W4_CUCME (LYR motif-containing protein At3g19508 OS=Cucumis melo OX=3656 GN=LOC103496191 PE=3 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 1.2e-38 Identity = 79/82 (96.34%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of Cla97C05G092700 vs. TrEMBL
Match: tr|A0A0A0L970|A0A0A0L970_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G199560 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 6.7e-37 Identity = 76/81 (93.83%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cla97C05G092700 vs. TrEMBL
Match: tr|A0A2P4J593|A0A2P4J593_QUESU (Lyr motif-containing protein OS=Quercus suber OX=58331 GN=CFP56_23416 PE=3 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 1.4e-34 Identity = 71/81 (87.65%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Cla97C05G092700 vs. TrEMBL
Match: tr|A0A2N9JAF8|A0A2N9JAF8_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS61435 PE=3 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.8e-34 Identity = 72/81 (88.89%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Cla97C05G092700 vs. TrEMBL
Match: tr|A0A2P5EYL0|A0A2P5EYL0_9ROSA (LYR motif-containing protein OS=Trema orientalis OX=63057 GN=TorRG33x02_136810 PE=3 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.8e-34 Identity = 70/82 (85.37%), Postives = 78/82 (95.12%), Query Frame = 0
BLAST of Cla97C05G092700 vs. Swiss-Prot
Match: sp|Q1G3M2|LYRM9_ARATH (LYR motif-containing protein At3g19508 OS=Arabidopsis thaliana OX=3702 GN=At3g19508 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.5e-28 Identity = 60/81 (74.07%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of Cla97C05G092700 vs. Swiss-Prot
Match: sp|A9SNJ1|LYRM9_PHYPA (LYR motif-containing protein PHYPADRAFT_186863 OS=Physcomitrella patens subsp. patens OX=3218 GN=PHYPADRAFT_186863 PE=3 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.4e-10 Identity = 32/58 (55.17%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of Cla97C05G092700 vs. TAIR10
Match: AT3G19508.1 (unknown protein) HSP 1 Score: 126.3 bits (316), Expect = 8.5e-30 Identity = 60/81 (74.07%), Postives = 70/81 (86.42%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|