Carg22236 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGTTTCCAGGATGTCTTTTGGATTTGTGGCTGCCGCTGCGCTCATCTTTGCCATCTTCTTGCCGGTTGCTCAGCCTCAGTCCTTGGCTCCGGCACCCGCTCCCACCAGCGACGGTTAGTTCTCTTCTTAATTTCTATTTCTTTAAGTTTTGTTTTGTATTTTTGTTCTAGATCTGTGTGGACTGTTGATCTCTGGCTTGAAATTAGTTTTGTTTGTTTATTCTTTGTTTCTGGATTATTTTGCGAGTTTCAGTTTCTGAGTTACCAAAACATTGTTTCGGTTTCCGGTTCTTCTTTGTTTCCGGATTATTTTGAGAGTTTCAGTTTCTGAGTTACCAAAACATTGTTTCGGTTTCCGTTTCTTGGTGAATTGTGATTAAAGATATTAAGCGCAAATCTTCACTTTTTTTCCCCTTTAGTTTTGATTGTTTGTTCAAGCCTTGGTGGATCTATTTTCCTACACGTATGTGTATTCTCAATTTTGCGAGAGTTCATTAGCATCAATTTGTGGACCAAATGTTAGAAATGACAAATAATACAGAAGCTATTTTCTTGTATTCGTAACAACGGCATAAAGTTATCTTATAGTTTCTATAAACTATTAATTTGCGAGTGTAATTAAACCTATTGCCATGATTATGAAAAGTAATTCTGTTTGCTATTTGGTTGGCCTGACTACTATTACGTTACCTTTTAGAACAAAGGTGTTCGGTCTTGATGTCTTATCCTCAGAAATTCATTTTAAATAGTTCTTTGAAATGCAAAATCCTAAGGAATTAGGGTTGAAATTCATAGATTTCTTAGTGAACTTAATTGGTATCTTTAAAACGTCATTTCACAGGGACATCCATAGACCAAGGGATAGCTTATGTGTTGATGTTGGTGGCATTGGCACTCACATATCTCATCCACAACGCTGACTTATCCAACAGCTTCTAA ATGGCGGTTTCCAGGATGTCTTTTGGATTTGTGGCTGCCGCTGCGCTCATCTTTGCCATCTTCTTGCCGGTTGCTCAGCCTCAGTCCTTGGCTCCGGCACCCGCTCCCACCAGCGACGGGACATCCATAGACCAAGGGATAGCTTATGTGTTGATGTTGGTGGCATTGGCACTCACATATCTCATCCACAACGCTGACTTATCCAACAGCTTCTAA ATGGCGGTTTCCAGGATGTCTTTTGGATTTGTGGCTGCCGCTGCGCTCATCTTTGCCATCTTCTTGCCGGTTGCTCAGCCTCAGTCCTTGGCTCCGGCACCCGCTCCCACCAGCGACGGGACATCCATAGACCAAGGGATAGCTTATGTGTTGATGTTGGTGGCATTGGCACTCACATATCTCATCCACAACGCTGACTTATCCAACAGCTTCTAA MAVSRMSFGFVAAAALIFAIFLPVAQPQSLAPAPAPTSDGTSIDQGIAYVLMLVALALTYLIHNADLSNSF
BLAST of Carg22236 vs. NCBI nr
Match: XP_022931316.1 (arabinogalactan peptide 22-like [Cucurbita moschata]) HSP 1 Score: 129.8 bits (325), Expect = 3.7e-27 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Carg22236 vs. NCBI nr
Match: XP_022985432.1 (arabinogalactan peptide 20 [Cucurbita maxima]) HSP 1 Score: 127.9 bits (320), Expect = 1.4e-26 Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Carg22236 vs. NCBI nr
Match: XP_022136454.1 (arabinogalactan peptide 22-like [Momordica charantia]) HSP 1 Score: 122.5 bits (306), Expect = 5.9e-25 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Carg22236 vs. NCBI nr
Match: XP_023522233.1 (arabinogalactan peptide 22-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 117.5 bits (293), Expect = 1.9e-23 Identity = 62/70 (88.57%), Postives = 67/70 (95.71%), Query Frame = 0
BLAST of Carg22236 vs. NCBI nr
Match: XP_022941572.1 (arabinogalactan peptide 22-like [Cucurbita moschata]) HSP 1 Score: 116.3 bits (290), Expect = 4.2e-23 Identity = 62/70 (88.57%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of Carg22236 vs. TAIR10
Match: AT5G24105.1 (arabinogalactan protein 41) HSP 1 Score: 84.0 bits (206), Expect = 4.2e-17 Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Carg22236 vs. TAIR10
Match: AT3G61640.1 (arabinogalactan protein 20) HSP 1 Score: 82.4 bits (202), Expect = 1.2e-16 Identity = 44/67 (65.67%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Carg22236 vs. TAIR10
Match: AT2G46330.1 (arabinogalactan protein 16) HSP 1 Score: 80.1 bits (196), Expect = 6.1e-16 Identity = 44/68 (64.71%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of Carg22236 vs. TAIR10
Match: AT5G53250.1 (arabinogalactan protein 22) HSP 1 Score: 55.5 bits (132), Expect = 1.6e-08 Identity = 33/63 (52.38%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Carg22236 vs. Swiss-Prot
Match: sp|Q8L9T8|AGP41_ARATH (Arabinogalactan protein 41 OS=Arabidopsis thaliana OX=3702 GN=AGP41 PE=1 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.6e-16 Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Carg22236 vs. Swiss-Prot
Match: sp|Q9M373|AGP20_ARATH (Arabinogalactan protein 20 OS=Arabidopsis thaliana OX=3702 GN=AGP20 PE=1 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.2e-15 Identity = 44/67 (65.67%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Carg22236 vs. Swiss-Prot
Match: sp|O82337|AGP16_ARATH (Arabinogalactan protein 16 OS=Arabidopsis thaliana OX=3702 GN=AGP16 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.1e-14 Identity = 44/68 (64.71%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of Carg22236 vs. Swiss-Prot
Match: sp|Q9FK16|AGP22_ARATH (Arabinogalactan protein 22 OS=Arabidopsis thaliana OX=3702 GN=AGP22 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.9e-07 Identity = 33/63 (52.38%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Carg22236 vs. TrEMBL
Match: tr|A0A1S3BS55|A0A1S3BS55_CUCME (arabinogalactan peptide 22-like OS=Cucumis melo OX=3656 GN=LOC103493115 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 2.4e-22 Identity = 61/70 (87.14%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of Carg22236 vs. TrEMBL
Match: tr|A0A0A0KZS8|A0A0A0KZS8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G051380 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 5.2e-22 Identity = 60/67 (89.55%), Postives = 62/67 (92.54%), Query Frame = 0
BLAST of Carg22236 vs. TrEMBL
Match: tr|A0A2P4N2B7|A0A2P4N2B7_QUESU (Arabinogalactan peptide 20 OS=Quercus suber OX=58331 GN=CFP56_23693 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.5e-18 Identity = 52/68 (76.47%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of Carg22236 vs. TrEMBL
Match: tr|A0A1U8AFS3|A0A1U8AFS3_NELNU (arabinogalactan peptide 20-like OS=Nelumbo nucifera OX=4432 GN=LOC104603947 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.5e-18 Identity = 54/69 (78.26%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of Carg22236 vs. TrEMBL
Match: tr|A0A2I4DJ18|A0A2I4DJ18_9ROSI (arabinogalactan peptide 22-like OS=Juglans regia OX=51240 GN=LOC108980617 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.7e-17 Identity = 57/72 (79.17%), Postives = 59/72 (81.94%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|