Cucsa.025370 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGAAAACACAGGCATGCCAGAGAGATCCATAGAATTTAAGTACGATTTCACCGGCGGTGGCAGTAGCGGAGTTGGTGGTAGCACAGGTGGTTCGAGTGAGGAAGCTGGCTACGGCGTTGGCGGGGTGGTAAAAGAGCAAGATCGGTtACTtCCAATAGCAAATGTGGGGAGGATAATGAAGCAAATTCTACCTCCAAATGCCAAAATCTCAAAAGAAGCTAAAGAAACTATGCAAGAATGCGTGTCGGAGTTCATCAGTTTCGTGACGGGGGAGGCGTCAGATAAGTGCCATAAGGAGAAGAGGAAGACTGTTAATGGTGATGATATTTGCTGTGCTTTGGCTACACTTGGATTTGATGATTATGCTGAGCCTTTGAGAAGGTATTTGGTTAGGTATAGAGATATGGAAGGGGAGAGAGCTCAACAAAACAAGGGATGTTGCAATAATA ATGGATGAAAACACAGGCATGCCAGAGAGATCCATAGAATTTAAGTACGATTTCACCGGCGGTGGCAGTAGCGGAGTTGGTGGTAGCACAGGTGGTTCGAGTGAGGAAGCTGGCTACGGCGTTGGCGGGGTGGTAAAAGAGCAAGATCGGTTACTTCCAATAGCAAATGTGGGGAGGATAATGAAGCAAATTCTACCTCCAAATGCCAAAATCTCAAAAGAAGCTAAAGAAACTATGCAAGAATGCGTGTCGGAGTTCATCAGTTTCGTGACGGGGGAGGCGTCAGATAAGTGCCATAAGGAGAAGAGGAAGACTGTTAATGGTGATGATATTTGCTGTGCTTTGGCTACACTTGGATTTGATGATTATGCTGAGCCTTTGAGAAGGTATTTGGTTAGGTATAGAGATATGGAAGGGGAGAGAGCTCAACAAAACAAGGGATGTTGCaataata ATGGATGAAAACACAGGCATGCCAGAGAGATCCATAGAATTTAAGTACGATTTCACCGGCGGTGGCAGTAGCGGAGTTGGTGGTAGCACAGGTGGTTCGAGTGAGGAAGCTGGCTACGGCGTTGGCGGGGTGGTAAAAGAGCAAGATCGGTtACTtCCAATAGCAAATGTGGGGAGGATAATGAAGCAAATTCTACCTCCAAATGCCAAAATCTCAAAAGAAGCTAAAGAAACTATGCAAGAATGCGTGTCGGAGTTCATCAGTTTCGTGACGGGGGAGGCGTCAGATAAGTGCCATAAGGAGAAGAGGAAGACTGTTAATGGTGATGATATTTGCTGTGCTTTGGCTACACTTGGATTTGATGATTATGCTGAGCCTTTGAGAAGGTATTTGGTTAGGTATAGAGATATGGAAGGGGAGAGAGCTCAACAAAACAAGGGATGTTGCAATAATA MDENTGMPERSIEFKYDFTGGGSSGVGGSTGGSSEEAGYGVGGVVKEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICCALATLGFDDYAEPLRRYLVRYRDMEGERAQQNKGCCNNX
BLAST of Cucsa.025370 vs. Swiss-Prot
Match: NFYB5_ARATH (Nuclear transcription factor Y subunit B-5 OS=Arabidopsis thaliana GN=NFYB5 PE=2 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 7.6e-42 Identity = 83/98 (84.69%), Postives = 90/98 (91.84%), Query Frame = 1
BLAST of Cucsa.025370 vs. Swiss-Prot
Match: NFYB3_ORYSJ (Nuclear transcription factor Y subunit B-3 OS=Oryza sativa subsp. japonica GN=NFYB3 PE=1 SV=2) HSP 1 Score: 165.6 bits (418), Expect = 4.2e-40 Identity = 78/121 (64.46%), Postives = 95/121 (78.51%), Query Frame = 1
BLAST of Cucsa.025370 vs. Swiss-Prot
Match: NFYB_MAIZE (Nuclear transcription factor Y subunit B OS=Zea mays GN=NFY2 PE=2 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 7.9e-39 Identity = 76/118 (64.41%), Postives = 94/118 (79.66%), Query Frame = 1
BLAST of Cucsa.025370 vs. Swiss-Prot
Match: NFYB7_ARATH (Nuclear transcription factor Y subunit B-7 OS=Arabidopsis thaliana GN=NFYB7 PE=2 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 1.0e-38 Identity = 80/125 (64.00%), Postives = 92/125 (73.60%), Query Frame = 1
BLAST of Cucsa.025370 vs. Swiss-Prot
Match: NFYB1_ARATH (Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana GN=NFYB1 PE=1 SV=2) HSP 1 Score: 158.7 bits (400), Expect = 5.1e-38 Identity = 80/129 (62.02%), Postives = 96/129 (74.42%), Query Frame = 1
BLAST of Cucsa.025370 vs. TrEMBL
Match: A0A0A0K954_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G395250 PE=4 SV=1) HSP 1 Score: 309.3 bits (791), Expect = 2.6e-81 Identity = 150/151 (99.34%), Postives = 150/151 (99.34%), Query Frame = 1
BLAST of Cucsa.025370 vs. TrEMBL
Match: A0A0H3XV97_VERFO (Nuclear transcription factor Y subunit B-9 OS=Vernicia fordii PE=2 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 1.2e-49 Identity = 102/120 (85.00%), Postives = 107/120 (89.17%), Query Frame = 1
BLAST of Cucsa.025370 vs. TrEMBL
Match: I1L7X0_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_10G020100 PE=4 SV=1) HSP 1 Score: 203.8 bits (517), Expect = 1.5e-49 Identity = 107/147 (72.79%), Postives = 117/147 (79.59%), Query Frame = 1
BLAST of Cucsa.025370 vs. TrEMBL
Match: A0A0B2P810_GLYSO (Nuclear transcription factor Y subunit B-5 OS=Glycine soja GN=glysoja_010966 PE=4 SV=1) HSP 1 Score: 203.8 bits (517), Expect = 1.5e-49 Identity = 107/147 (72.79%), Postives = 117/147 (79.59%), Query Frame = 1
BLAST of Cucsa.025370 vs. TrEMBL
Match: A0A0L9TWP1_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g107600 PE=4 SV=1) HSP 1 Score: 202.6 bits (514), Expect = 3.4e-49 Identity = 102/133 (76.69%), Postives = 109/133 (81.95%), Query Frame = 1
BLAST of Cucsa.025370 vs. TAIR10
Match: AT2G47810.1 (AT2G47810.1 nuclear factor Y, subunit B5) HSP 1 Score: 171.4 bits (433), Expect = 4.3e-43 Identity = 83/98 (84.69%), Postives = 90/98 (91.84%), Query Frame = 1
BLAST of Cucsa.025370 vs. TAIR10
Match: AT2G13570.1 (AT2G13570.1 nuclear factor Y, subunit B7) HSP 1 Score: 161.0 bits (406), Expect = 5.8e-40 Identity = 80/125 (64.00%), Postives = 92/125 (73.60%), Query Frame = 1
BLAST of Cucsa.025370 vs. TAIR10
Match: AT5G47640.1 (AT5G47640.1 nuclear factor Y, subunit B2) HSP 1 Score: 157.9 bits (398), Expect = 4.9e-39 Identity = 78/122 (63.93%), Postives = 93/122 (76.23%), Query Frame = 1
BLAST of Cucsa.025370 vs. TAIR10
Match: AT3G53340.1 (AT3G53340.1 nuclear factor Y, subunit B10) HSP 1 Score: 157.9 bits (398), Expect = 4.9e-39 Identity = 80/129 (62.02%), Postives = 96/129 (74.42%), Query Frame = 1
BLAST of Cucsa.025370 vs. TAIR10
Match: AT4G14540.1 (AT4G14540.1 nuclear factor Y, subunit B3) HSP 1 Score: 153.7 bits (387), Expect = 9.2e-38 Identity = 73/110 (66.36%), Postives = 91/110 (82.73%), Query Frame = 1
BLAST of Cucsa.025370 vs. NCBI nr
Match: gi|778727953|ref|XP_011659350.1| (PREDICTED: nuclear transcription factor Y subunit B-5 [Cucumis sativus]) HSP 1 Score: 309.3 bits (791), Expect = 3.7e-81 Identity = 150/151 (99.34%), Postives = 150/151 (99.34%), Query Frame = 1
BLAST of Cucsa.025370 vs. NCBI nr
Match: gi|659101456|ref|XP_008451614.1| (PREDICTED: nuclear transcription factor Y subunit B-1 [Cucumis melo]) HSP 1 Score: 308.9 bits (790), Expect = 4.9e-81 Identity = 149/151 (98.68%), Postives = 150/151 (99.34%), Query Frame = 1
BLAST of Cucsa.025370 vs. NCBI nr
Match: gi|951018285|ref|XP_014511739.1| (PREDICTED: nuclear transcription factor Y subunit B-5 [Vigna radiata var. radiata]) HSP 1 Score: 204.9 bits (520), Expect = 9.9e-50 Identity = 102/133 (76.69%), Postives = 114/133 (85.71%), Query Frame = 1
BLAST of Cucsa.025370 vs. NCBI nr
Match: gi|837378381|gb|AKM95036.1| (nuclear transcription factor Y subunit B-9 [Vernicia fordii]) HSP 1 Score: 204.1 bits (518), Expect = 1.7e-49 Identity = 102/120 (85.00%), Postives = 107/120 (89.17%), Query Frame = 1
BLAST of Cucsa.025370 vs. NCBI nr
Match: gi|356536735|ref|XP_003536891.1| (PREDICTED: nuclear transcription factor Y subunit B-5-like [Glycine max]) HSP 1 Score: 203.8 bits (517), Expect = 2.2e-49 Identity = 107/147 (72.79%), Postives = 117/147 (79.59%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|