CmaCh04G013220 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGTAATCGGCAAAAAACAGCCGAAGAGAACCAAGAAATCGGCCGCCAATTTCAAAGTCGTGTACATTTCGAGTCCGATGAAGGTGAAAACCAGCGCCTCGAAGTTTAGATCTCTCGTCCAGAAACTCACCGGCCAGGACTCTGACGCCGAGAGTTTCCTGGAACTCATCGCAGGTGATCGGAACTTTCAATCGTCCGCGTTCCTCGATTACCAAATCCTCGGCGATGACAATCTAATTAATCGCGACCATCGTCTTGTGGCGGGAAAGATCGAAACGGCGGCATATCAATCGTTGGTTGCTCCGCCGGCAGATGATTTGGTTCTGCAGAACTTCGATGCGAGTTTTGAAGAAATGCTCCGTGGATTTTTTGCATGA ATGGATGTAATCGGCAAAAAACAGCCGAAGAGAACCAAGAAATCGGCCGCCAATTTCAAAGTCGTGTACATTTCGAGTCCGATGAAGGTGAAAACCAGCGCCTCGAAGTTTAGATCTCTCGTCCAGAAACTCACCGGCCAGGACTCTGACGCCGAGAGTTTCCTGGAACTCATCGCAGGTGATCGGAACTTTCAATCGTCCGCGTTCCTCGATTACCAAATCCTCGGCGATGACAATCTAATTAATCGCGACCATCGTCTTGTGGCGGGAAAGATCGAAACGGCGGCATATCAATCGTTGGTTGCTCCGCCGGCAGATGATTTGGTTCTGCAGAACTTCGATGCGAGTTTTGAAGAAATGCTCCGTGGATTTTTTGCATGA ATGGATGTAATCGGCAAAAAACAGCCGAAGAGAACCAAGAAATCGGCCGCCAATTTCAAAGTCGTGTACATTTCGAGTCCGATGAAGGTGAAAACCAGCGCCTCGAAGTTTAGATCTCTCGTCCAGAAACTCACCGGCCAGGACTCTGACGCCGAGAGTTTCCTGGAACTCATCGCAGGTGATCGGAACTTTCAATCGTCCGCGTTCCTCGATTACCAAATCCTCGGCGATGACAATCTAATTAATCGCGACCATCGTCTTGTGGCGGGAAAGATCGAAACGGCGGCATATCAATCGTTGGTTGCTCCGCCGGCAGATGATTTGGTTCTGCAGAACTTCGATGCGAGTTTTGAAGAAATGCTCCGTGGATTTTTTGCATGA MDVIGKKQPKRTKKSAANFKVVYISSPMKVKTSASKFRSLVQKLTGQDSDAESFLELIAGDRNFQSSAFLDYQILGDDNLINRDHRLVAGKIETAAYQSLVAPPADDLVLQNFDASFEEMLRGFFA
BLAST of CmaCh04G013220 vs. TrEMBL
Match: D1MWZ4_CITLA (Sigma factor binding protein 1 OS=Citrullus lanatus subsp. vulgaris GN=CitSIB PE=2 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 2.2e-33 Identity = 92/135 (68.15%), Postives = 104/135 (77.04%), Query Frame = 1
BLAST of CmaCh04G013220 vs. TrEMBL
Match: A0A0A0KTR9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G623915 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 9.2e-24 Identity = 72/131 (54.96%), Postives = 94/131 (71.76%), Query Frame = 1
BLAST of CmaCh04G013220 vs. TrEMBL
Match: A0A067L8W8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_24548 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.3e-11 Identity = 44/72 (61.11%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of CmaCh04G013220 vs. TrEMBL
Match: M5XE50_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013276mg PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 5.8e-10 Identity = 47/114 (41.23%), Postives = 65/114 (57.02%), Query Frame = 1
BLAST of CmaCh04G013220 vs. TrEMBL
Match: A0A022RSA8_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a015864mg PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.7e-09 Identity = 48/129 (37.21%), Postives = 72/129 (55.81%), Query Frame = 1
BLAST of CmaCh04G013220 vs. TAIR10
Match: AT3G56710.1 (AT3G56710.1 sigma factor binding protein 1) HSP 1 Score: 50.8 bits (120), Expect = 7.0e-07 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 1
BLAST of CmaCh04G013220 vs. NCBI nr
Match: gi|270309002|dbj|BAI52954.1| (sigma factor binding protein 1 [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 149.8 bits (377), Expect = 3.1e-33 Identity = 92/135 (68.15%), Postives = 104/135 (77.04%), Query Frame = 1
BLAST of CmaCh04G013220 vs. NCBI nr
Match: gi|659092245|ref|XP_008446972.1| (PREDICTED: sigma factor binding protein 1, chloroplastic-like [Cucumis melo]) HSP 1 Score: 124.8 bits (312), Expect = 1.1e-25 Identity = 77/132 (58.33%), Postives = 99/132 (75.00%), Query Frame = 1
BLAST of CmaCh04G013220 vs. NCBI nr
Match: gi|449449264|ref|XP_004142385.1| (PREDICTED: uncharacterized protein LOC101217123 [Cucumis sativus]) HSP 1 Score: 117.9 bits (294), Expect = 1.3e-23 Identity = 72/131 (54.96%), Postives = 94/131 (71.76%), Query Frame = 1
BLAST of CmaCh04G013220 vs. NCBI nr
Match: gi|802574171|ref|XP_012068696.1| (PREDICTED: uncharacterized protein LOC105631246 [Jatropha curcas]) HSP 1 Score: 76.6 bits (187), Expect = 3.4e-11 Identity = 44/72 (61.11%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of CmaCh04G013220 vs. NCBI nr
Match: gi|470145903|ref|XP_004308571.1| (PREDICTED: sigma factor binding protein 1, chloroplastic-like [Fragaria vesca subsp. vesca]) HSP 1 Score: 76.6 bits (187), Expect = 3.4e-11 Identity = 51/129 (39.53%), Postives = 74/129 (57.36%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|