Cla97C01G011570 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAACCATGTCAACTGCAAAGCTCCCTACCCGCTGCATGTACAACGCGCCGTGTAAAAATCAACTCAGAAGTGCCATAATCAAGTGTCCATGGTCAATTGGATCTACGAGCAACATTTCAAAATCATTTGGCTTGAAATCATGTCCCTCATTCAGAGCCTGTGCAATGGCAGTTTACAAGATTAAACTGGTTGAACCATGTGGGAAAGAGCATGAGTTTGAGGCATCTGATGATACTTACATTCTTGATGCAGCTGAAGAAGCAGGAGTTGACTTACCTTATTCTTGCAGGGCAGGCGCGTGTTCTACGTGCGCCGGGAAAATGGTTTCGGGTTCAGTTGATCAGTCGGACGGGTCGTTCCTTGATGATAGTCAAATGGCAGAGGGTTATTTGTTAACCTGCGTTTCATTACCAACGGCGGACTGTGTGATTCACACACATAAGGAAGGAGAACTGATCTGA ATGTCAACCATGTCAACTGCAAAGCTCCCTACCCGCTGCATGTACAACGCGCCGTGTAAAAATCAACTCAGAAGTGCCATAATCAAGTGTCCATGGTCAATTGGATCTACGAGCAACATTTCAAAATCATTTGGCTTGAAATCATGTCCCTCATTCAGAGCCTGTGCAATGGCAGTTTACAAGATTAAACTGGTTGAACCATGTGGGAAAGAGCATGAGTTTGAGGCATCTGATGATACTTACATTCTTGATGCAGCTGAAGAAGCAGGAGTTGACTTACCTTATTCTTGCAGGGCAGGCGCGTGTTCTACGTGCGCCGGGAAAATGGTTTCGGGTTCAGTTGATCAGTCGGACGGGTCGTTCCTTGATGATAGTCAAATGGCAGAGGGTTATTTGTTAACCTGCGTTTCATTACCAACGGCGGACTGTGTGATTCACACACATAAGGAAGGAGAACTGATCTGA ATGTCAACCATGTCAACTGCAAAGCTCCCTACCCGCTGCATGTACAACGCGCCGTGTAAAAATCAACTCAGAAGTGCCATAATCAAGTGTCCATGGTCAATTGGATCTACGAGCAACATTTCAAAATCATTTGGCTTGAAATCATGTCCCTCATTCAGAGCCTGTGCAATGGCAGTTTACAAGATTAAACTGGTTGAACCATGTGGGAAAGAGCATGAGTTTGAGGCATCTGATGATACTTACATTCTTGATGCAGCTGAAGAAGCAGGAGTTGACTTACCTTATTCTTGCAGGGCAGGCGCGTGTTCTACGTGCGCCGGGAAAATGGTTTCGGGTTCAGTTGATCAGTCGGACGGGTCGTTCCTTGATGATAGTCAAATGGCAGAGGGTTATTTGTTAACCTGCGTTTCATTACCAACGGCGGACTGTGTGATTCACACACATAAGGAAGGAGAACTGATCTGA MSTMSTAKLPTRCMYNAPCKNQLRSAIIKCPWSIGSTSNISKSFGLKSCPSFRACAMAVYKIKLVEPCGKEHEFEASDDTYILDAAEEAGVDLPYSCRAGACSTCAGKMVSGSVDQSDGSFLDDSQMAEGYLLTCVSLPTADCVIHTHKEGELI
BLAST of Cla97C01G011570 vs. NCBI nr
Match: XP_022142635.1 (ferredoxin, root R-B2 [Momordica charantia]) HSP 1 Score: 277.7 bits (709), Expect = 2.4e-71 Identity = 137/154 (88.96%), Postives = 142/154 (92.21%), Query Frame = 0
BLAST of Cla97C01G011570 vs. NCBI nr
Match: KGN64931.1 (hypothetical protein Csa_1G163160 [Cucumis sativus]) HSP 1 Score: 275.0 bits (702), Expect = 1.5e-70 Identity = 135/154 (87.66%), Postives = 139/154 (90.26%), Query Frame = 0
BLAST of Cla97C01G011570 vs. NCBI nr
Match: XP_022944833.1 (uncharacterized protein LOC111449248 isoform X2 [Cucurbita moschata]) HSP 1 Score: 273.1 bits (697), Expect = 5.8e-70 Identity = 136/156 (87.18%), Postives = 142/156 (91.03%), Query Frame = 0
BLAST of Cla97C01G011570 vs. NCBI nr
Match: XP_023541284.1 (ferredoxin-3, chloroplastic [Cucurbita pepo subsp. pepo]) HSP 1 Score: 270.4 bits (690), Expect = 3.8e-69 Identity = 135/156 (86.54%), Postives = 142/156 (91.03%), Query Frame = 0
BLAST of Cla97C01G011570 vs. NCBI nr
Match: XP_022967109.1 (uncharacterized protein LOC111466612 [Cucurbita maxima] >XP_022967110.1 uncharacterized protein LOC111466612 [Cucurbita maxima]) HSP 1 Score: 270.0 bits (689), Expect = 4.9e-69 Identity = 135/156 (86.54%), Postives = 142/156 (91.03%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TrEMBL
Match: tr|A0A0A0LY90|A0A0A0LY90_CUCSA (Ferredoxin OS=Cucumis sativus OX=3659 GN=Csa_1G163160 PE=3 SV=1) HSP 1 Score: 275.0 bits (702), Expect = 1.0e-70 Identity = 135/154 (87.66%), Postives = 139/154 (90.26%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TrEMBL
Match: tr|A0A2P4M2V0|A0A2P4M2V0_QUESU (Ferredoxin OS=Quercus suber OX=58331 GN=CFP56_70278 PE=3 SV=1) HSP 1 Score: 234.6 bits (597), Expect = 1.5e-58 Identity = 112/153 (73.20%), Postives = 132/153 (86.27%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TrEMBL
Match: tr|A0A2N9INM6|A0A2N9INM6_FAGSY (Ferredoxin OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS55038 PE=3 SV=1) HSP 1 Score: 232.6 bits (592), Expect = 5.8e-58 Identity = 114/153 (74.51%), Postives = 130/153 (84.97%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TrEMBL
Match: tr|F6HHG1|F6HHG1_VITVI (Ferredoxin OS=Vitis vinifera OX=29760 GN=VIT_06s0080g00410 PE=3 SV=1) HSP 1 Score: 229.6 bits (584), Expect = 4.9e-57 Identity = 108/150 (72.00%), Postives = 127/150 (84.67%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TrEMBL
Match: tr|A5B3C7|A5B3C7_VITVI (Ferredoxin OS=Vitis vinifera OX=29760 GN=VITISV_038770 PE=3 SV=1) HSP 1 Score: 228.8 bits (582), Expect = 8.3e-57 Identity = 108/150 (72.00%), Postives = 126/150 (84.00%), Query Frame = 0
BLAST of Cla97C01G011570 vs. Swiss-Prot
Match: sp|P27788|FER3_MAIZE (Ferredoxin-3, chloroplastic OS=Zea mays OX=4577 GN=FDX3 PE=1 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 7.5e-45 Identity = 92/151 (60.93%), Postives = 107/151 (70.86%), Query Frame = 0
BLAST of Cla97C01G011570 vs. Swiss-Prot
Match: sp|Q9ZQG8|FER3_ARATH (Ferredoxin-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FD3 PE=1 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 4.9e-44 Identity = 92/154 (59.74%), Postives = 115/154 (74.68%), Query Frame = 0
BLAST of Cla97C01G011570 vs. Swiss-Prot
Match: sp|P94044|FER6_MAIZE (Ferredoxin-6, chloroplastic OS=Zea mays OX=4577 GN=FDX6 PE=2 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 8.1e-39 Identity = 90/162 (55.56%), Postives = 109/162 (67.28%), Query Frame = 0
BLAST of Cla97C01G011570 vs. Swiss-Prot
Match: sp|P14937|FER2_RAPSA (Ferredoxin, root R-B2 OS=Raphanus sativus OX=3726 PE=1 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 8.4e-36 Identity = 68/96 (70.83%), Postives = 82/96 (85.42%), Query Frame = 0
BLAST of Cla97C01G011570 vs. Swiss-Prot
Match: sp|O04090|FER1_ARATH (Ferredoxin-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FD1 PE=1 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 2.4e-35 Identity = 74/115 (64.35%), Postives = 89/115 (77.39%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TAIR10
Match: AT2G27510.1 (ferredoxin 3) HSP 1 Score: 178.7 bits (452), Expect = 2.7e-45 Identity = 92/154 (59.74%), Postives = 115/154 (74.68%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TAIR10
Match: AT1G10960.1 (ferredoxin 1) HSP 1 Score: 149.8 bits (377), Expect = 1.3e-36 Identity = 74/115 (64.35%), Postives = 89/115 (77.39%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TAIR10
Match: AT1G60950.1 (2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 147.5 bits (371), Expect = 6.7e-36 Identity = 79/155 (50.97%), Postives = 102/155 (65.81%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TAIR10
Match: AT5G10000.1 (ferredoxin 4) HSP 1 Score: 129.0 bits (323), Expect = 2.5e-30 Identity = 54/94 (57.45%), Postives = 76/94 (80.85%), Query Frame = 0
BLAST of Cla97C01G011570 vs. TAIR10
Match: AT4G14890.1 (2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 84.3 bits (207), Expect = 7.0e-17 Identity = 44/95 (46.32%), Postives = 56/95 (58.95%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|