Cla001097 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAACCATGTCAACTGCAAAGCTCCCTACCCGCTGCATGTACAACGCGCCGTGTAAAAATCAACTCAGAAGTGCCATAATCAAGTGTCCATGGTCAATTGGATCTACGAGCAACATTTCAAAATCATTTGGCTTGAAATCATGTCCCTCATTCAGAGCCTGTGCAATGGCAGTTTACAAGATTAAACTGGTTGAACCATGTGGGAAAGAGCATGAGTTTGAGGCATCTGATGATACTTACATTCTTGATGCAGCTGAAGAAGCAGGAGTTGACTTACCTTATTCTTGCAGGGCAGGCGCGTGTTCTACGTGCGCCGGGAAAATGGTTTCGGGTTCAGTTGATCAGTCGGACGGGTCGTTCCTTGATGATAGTCAAATGGCAGAGGGTTATTTGTTAACCTGCGTTTCATTACCAACGGCGGACTGTGTGATTCACACACATAAGGAAGGAGAACTGATCTGA ATGTCAACCATGTCAACTGCAAAGCTCCCTACCCGCTGCATGTACAACGCGCCGTGTAAAAATCAACTCAGAAGTGCCATAATCAAGTGTCCATGGTCAATTGGATCTACGAGCAACATTTCAAAATCATTTGGCTTGAAATCATGTCCCTCATTCAGAGCCTGTGCAATGGCAGTTTACAAGATTAAACTGGTTGAACCATGTGGGAAAGAGCATGAGTTTGAGGCATCTGATGATACTTACATTCTTGATGCAGCTGAAGAAGCAGGAGTTGACTTACCTTATTCTTGCAGGGCAGGCGCGTGTTCTACGTGCGCCGGGAAAATGGTTTCGGGTTCAGTTGATCAGTCGGACGGGTCGTTCCTTGATGATAGTCAAATGGCAGAGGGTTATTTGTTAACCTGCGTTTCATTACCAACGGCGGACTGTGTGATTCACACACATAAGGAAGGAGAACTGATCTGA ATGTCAACCATGTCAACTGCAAAGCTCCCTACCCGCTGCATGTACAACGCGCCGTGTAAAAATCAACTCAGAAGTGCCATAATCAAGTGTCCATGGTCAATTGGATCTACGAGCAACATTTCAAAATCATTTGGCTTGAAATCATGTCCCTCATTCAGAGCCTGTGCAATGGCAGTTTACAAGATTAAACTGGTTGAACCATGTGGGAAAGAGCATGAGTTTGAGGCATCTGATGATACTTACATTCTTGATGCAGCTGAAGAAGCAGGAGTTGACTTACCTTATTCTTGCAGGGCAGGCGCGTGTTCTACGTGCGCCGGGAAAATGGTTTCGGGTTCAGTTGATCAGTCGGACGGGTCGTTCCTTGATGATAGTCAAATGGCAGAGGGTTATTTGTTAACCTGCGTTTCATTACCAACGGCGGACTGTGTGATTCACACACATAAGGAAGGAGAACTGATCTGA MSTMSTAKLPTRCMYNAPCKNQLRSAIIKCPWSIGSTSNISKSFGLKSCPSFRACAMAVYKIKLVEPCGKEHEFEASDDTYILDAAEEAGVDLPYSCRAGACSTCAGKMVSGSVDQSDGSFLDDSQMAEGYLLTCVSLPTADCVIHTHKEGELI
BLAST of Cla001097 vs. Swiss-Prot
Match: FER3_MAIZE (Ferredoxin-3, chloroplastic OS=Zea mays GN=FDX3 PE=2 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 4.4e-45 Identity = 92/151 (60.93%), Postives = 105/151 (69.54%), Query Frame = 1
BLAST of Cla001097 vs. Swiss-Prot
Match: FER3_ARATH (Ferredoxin-3, chloroplastic OS=Arabidopsis thaliana GN=FD3 PE=1 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 2.8e-44 Identity = 92/154 (59.74%), Postives = 113/154 (73.38%), Query Frame = 1
BLAST of Cla001097 vs. Swiss-Prot
Match: FER6_MAIZE (Ferredoxin-6, chloroplastic OS=Zea mays GN=FDX6 PE=2 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 3.6e-39 Identity = 90/162 (55.56%), Postives = 107/162 (66.05%), Query Frame = 1
BLAST of Cla001097 vs. Swiss-Prot
Match: FER2_RAPSA (Ferredoxin, root R-B2 OS=Raphanus sativus PE=1 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 1.4e-35 Identity = 68/96 (70.83%), Postives = 80/96 (83.33%), Query Frame = 1
BLAST of Cla001097 vs. Swiss-Prot
Match: FER1_ARATH (Ferredoxin-1, chloroplastic OS=Arabidopsis thaliana GN=FD1 PE=1 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.8e-35 Identity = 74/115 (64.35%), Postives = 87/115 (75.65%), Query Frame = 1
BLAST of Cla001097 vs. TrEMBL
Match: A0A0A0LY90_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G163160 PE=4 SV=1) HSP 1 Score: 276.2 bits (705), Expect = 2.5e-71 Identity = 135/154 (87.66%), Postives = 139/154 (90.26%), Query Frame = 1
BLAST of Cla001097 vs. TrEMBL
Match: F6HHG1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_06s0080g00410 PE=4 SV=1) HSP 1 Score: 230.3 bits (586), Expect = 1.6e-57 Identity = 108/150 (72.00%), Postives = 127/150 (84.67%), Query Frame = 1
BLAST of Cla001097 vs. TrEMBL
Match: A5B3C7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_038770 PE=4 SV=1) HSP 1 Score: 229.6 bits (584), Expect = 2.6e-57 Identity = 108/150 (72.00%), Postives = 126/150 (84.00%), Query Frame = 1
BLAST of Cla001097 vs. TrEMBL
Match: V7AFQ6_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_011G094400g PE=4 SV=1) HSP 1 Score: 227.6 bits (579), Expect = 1.0e-56 Identity = 108/154 (70.13%), Postives = 130/154 (84.42%), Query Frame = 1
BLAST of Cla001097 vs. TrEMBL
Match: A0A0S3SC87_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.06G165400 PE=4 SV=1) HSP 1 Score: 224.9 bits (572), Expect = 6.5e-56 Identity = 110/154 (71.43%), Postives = 129/154 (83.77%), Query Frame = 1
BLAST of Cla001097 vs. TAIR10
Match: AT2G27510.1 (AT2G27510.1 ferredoxin 3) HSP 1 Score: 179.5 bits (454), Expect = 1.6e-45 Identity = 92/154 (59.74%), Postives = 113/154 (73.38%), Query Frame = 1
BLAST of Cla001097 vs. TAIR10
Match: AT1G10960.1 (AT1G10960.1 ferredoxin 1) HSP 1 Score: 150.2 bits (378), Expect = 1.0e-36 Identity = 74/115 (64.35%), Postives = 87/115 (75.65%), Query Frame = 1
BLAST of Cla001097 vs. TAIR10
Match: AT1G60950.1 (AT1G60950.1 2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 148.7 bits (374), Expect = 3.0e-36 Identity = 79/155 (50.97%), Postives = 100/155 (64.52%), Query Frame = 1
BLAST of Cla001097 vs. TAIR10
Match: AT5G10000.1 (AT5G10000.1 ferredoxin 4) HSP 1 Score: 128.6 bits (322), Expect = 3.2e-30 Identity = 54/94 (57.45%), Postives = 74/94 (78.72%), Query Frame = 1
BLAST of Cla001097 vs. TAIR10
Match: AT4G14890.1 (AT4G14890.1 2Fe-2S ferredoxin-like superfamily protein) HSP 1 Score: 84.0 bits (206), Expect = 9.1e-17 Identity = 44/95 (46.32%), Postives = 54/95 (56.84%), Query Frame = 1
BLAST of Cla001097 vs. NCBI nr
Match: gi|700209835|gb|KGN64931.1| (hypothetical protein Csa_1G163160 [Cucumis sativus]) HSP 1 Score: 276.2 bits (705), Expect = 3.5e-71 Identity = 135/154 (87.66%), Postives = 139/154 (90.26%), Query Frame = 1
BLAST of Cla001097 vs. NCBI nr
Match: gi|659071691|ref|XP_008461439.1| (PREDICTED: ferredoxin, root R-B2 [Cucumis melo]) HSP 1 Score: 268.9 bits (686), Expect = 5.7e-69 Identity = 135/154 (87.66%), Postives = 139/154 (90.26%), Query Frame = 1
BLAST of Cla001097 vs. NCBI nr
Match: gi|731394574|ref|XP_010651884.1| (PREDICTED: ferredoxin-3, chloroplastic [Vitis vinifera]) HSP 1 Score: 230.3 bits (586), Expect = 2.2e-57 Identity = 108/150 (72.00%), Postives = 127/150 (84.67%), Query Frame = 1
BLAST of Cla001097 vs. NCBI nr
Match: gi|147819070|emb|CAN74125.1| (hypothetical protein VITISV_038770 [Vitis vinifera]) HSP 1 Score: 229.6 bits (584), Expect = 3.8e-57 Identity = 108/150 (72.00%), Postives = 126/150 (84.00%), Query Frame = 1
BLAST of Cla001097 vs. NCBI nr
Match: gi|593203955|ref|XP_007132438.1| (hypothetical protein PHAVU_011G094400g [Phaseolus vulgaris]) HSP 1 Score: 227.6 bits (579), Expect = 1.4e-56 Identity = 108/154 (70.13%), Postives = 130/154 (84.42%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|