Carg11845 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGAATTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCCGAGGAACAACTAGCTAGCGTTTTCAAGAACCACGATGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTTAGCTCGTTCAGAGTAGAAGAGGCACTACGTGCCGCTGATATCGACGGTGATGGTTTCATAAGCATGGCCGAGATGGACAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA ATGGGGAATTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCCGAGGAACAACTAGCTAGCGTTTTCAAGAACCACGATGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTTAGCTCGTTCAGAGTAGAAGAGGCACTACGTGCCGCTGATATCGACGGTGATGGTTTCATAAGCATGGCCGAGATGGACAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA ATGGGGAATTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCCGAGGAACAACTAGCTAGCGTTTTCAAGAACCACGATGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTTAGCTCGTTCAGAGTAGAAGAGGCACTACGTGCCGCTGATATCGACGGTGATGGTTTCATAAGCATGGCCGAGATGGACAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA MGNSKSKTYKRVLVPFSEEQLASVFKNHDGDGDGKLTKEELKQAFDYLGSRFSSFRVEEALRAADIDGDGFISMAEMDKLIQYAKSRKYTLC
BLAST of Carg11845 vs. NCBI nr
Match: KGN62511.1 (hypothetical protein Csa_2G357340 [Cucumis sativus]) HSP 1 Score: 133.7 bits (335), Expect = 3.3e-28 Identity = 68/91 (74.73%), Postives = 74/91 (81.32%), Query Frame = 0
BLAST of Carg11845 vs. NCBI nr
Match: XP_023538265.1 (probable calcium-binding protein CML15 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 114.4 bits (285), Expect = 2.1e-22 Identity = 58/85 (68.24%), Postives = 62/85 (72.94%), Query Frame = 0
BLAST of Carg11845 vs. NCBI nr
Match: POF10332.1 (calcium-binding allergen ole e 8 [Quercus suber]) HSP 1 Score: 83.6 bits (205), Expect = 3.9e-13 Identity = 40/87 (45.98%), Postives = 55/87 (63.22%), Query Frame = 0
BLAST of Carg11845 vs. NCBI nr
Match: POF10331.1 (putative calcium-binding protein cml26 [Quercus suber]) HSP 1 Score: 83.2 bits (204), Expect = 5.1e-13 Identity = 53/87 (60.92%), Postives = 71/87 (81.61%), Query Frame = 0
BLAST of Carg11845 vs. NCBI nr
Match: POE80202.1 (putative calcium-binding protein cml26 [Quercus suber]) HSP 1 Score: 77.8 bits (190), Expect = 2.1e-11 Identity = 33/58 (56.90%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of Carg11845 vs. TAIR10
Match: AT5G12180.1 (calcium-dependent protein kinase 17) HSP 1 Score: 40.0 bits (92), Expect = 9.0e-04 Identity = 23/67 (34.33%), Postives = 34/67 (50.75%), Query Frame = 0
BLAST of Carg11845 vs. TAIR10
Match: AT5G19360.1 (calcium-dependent protein kinase 34) HSP 1 Score: 40.0 bits (92), Expect = 9.0e-04 Identity = 23/67 (34.33%), Postives = 34/67 (50.75%), Query Frame = 0
BLAST of Carg11845 vs. TrEMBL
Match: tr|A0A0A0LRB6|A0A0A0LRB6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G357340 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 2.2e-28 Identity = 68/91 (74.73%), Postives = 74/91 (81.32%), Query Frame = 0
BLAST of Carg11845 vs. TrEMBL
Match: tr|A0A2P4LY04|A0A2P4LY04_QUESU (Calcium-binding allergen ole e 8 OS=Quercus suber OX=58331 GN=CFP56_50060 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 2.6e-13 Identity = 40/87 (45.98%), Postives = 55/87 (63.22%), Query Frame = 0
BLAST of Carg11845 vs. TrEMBL
Match: tr|A0A2P4LYQ6|A0A2P4LYQ6_QUESU (Putative calcium-binding protein cml26 OS=Quercus suber OX=58331 GN=CFP56_50059 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 3.4e-13 Identity = 53/87 (60.92%), Postives = 71/87 (81.61%), Query Frame = 0
BLAST of Carg11845 vs. TrEMBL
Match: tr|A0A2P4JHG4|A0A2P4JHG4_QUESU (Putative calcium-binding protein cml26 OS=Quercus suber OX=58331 GN=CFP56_74189 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.4e-11 Identity = 33/58 (56.90%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of Carg11845 vs. TrEMBL
Match: tr|A0A0A0LP43|A0A0A0LP43_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G357350 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 3.2e-11 Identity = 40/83 (48.19%), Postives = 49/83 (59.04%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|