Cp4.1LG11g01520 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGAACTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCAGAGGAGCAACTAGCTAGCGTTTTCAAAAACCACGACGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTCAGCTCGTTCAGAGTAGAAGAGGCACTACGTGCCGCTGATATCGACGGTGATGGTTTCATAAGCATGGCCGAGATGGACAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA ATGGGGAACTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCAGAGGAGCAACTAGCTAGCGTTTTCAAAAACCACGACGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTCAGCTCGTTCAGAGTAGAAGAGGCACTACGTGCCGCTGATATCGACGGTGATGGTTTCATAAGCATGGCCGAGATGGACAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA ATGGGGAACTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCAGAGGAGCAACTAGCTAGCGTTTTCAAAAACCACGACGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTCAGCTCGTTCAGAGTAGAAGAGGCACTACGTGCCGCTGATATCGACGGTGATGGTTTCATAAGCATGGCCGAGATGGACAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA MGNSKSKTYKRVLVPFSEEQLASVFKNHDGDGDGKLTKEELKQAFDYLGSRFSSFRVEEALRAADIDGDGFISMAEMDKLIQYAKSRKYTLC
BLAST of Cp4.1LG11g01520 vs. Swiss-Prot
Match: CML37_ARATH (Calcium-binding protein CML37 OS=Arabidopsis thaliana GN=CML37 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-07 Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. Swiss-Prot
Match: CALM_PLAFA (Calmodulin OS=Plasmodium falciparum PE=3 SV=4) HSP 1 Score: 55.1 bits (131), Expect = 4.8e-07 Identity = 26/65 (40.00%), Postives = 41/65 (63.08%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. Swiss-Prot
Match: CALM_BLAEM (Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3) HSP 1 Score: 55.1 bits (131), Expect = 4.8e-07 Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. Swiss-Prot
Match: CALM_PLAF7 (Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 4.8e-07 Identity = 26/65 (40.00%), Postives = 41/65 (63.08%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. Swiss-Prot
Match: CALM_PNECA (Calmodulin OS=Pneumocystis carinii PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.4e-06 Identity = 25/65 (38.46%), Postives = 39/65 (60.00%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TrEMBL
Match: A0A0A0LRB6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G357340 PE=4 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 2.9e-35 Identity = 77/91 (84.62%), Postives = 84/91 (92.31%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TrEMBL
Match: A0A0A0L4V0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G639740 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.2e-18 Identity = 43/83 (51.81%), Postives = 62/83 (74.70%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TrEMBL
Match: A0A0A0LP43_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G357350 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.1e-15 Identity = 46/83 (55.42%), Postives = 56/83 (67.47%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TrEMBL
Match: A0A0A0LL93_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G357850 PE=4 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.3e-14 Identity = 44/69 (63.77%), Postives = 54/69 (78.26%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TrEMBL
Match: A0A067L1J7_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04285 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 4.8e-14 Identity = 39/75 (52.00%), Postives = 57/75 (76.00%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TAIR10
Match: AT5G42380.1 (AT5G42380.1 calmodulin like 37) HSP 1 Score: 56.6 bits (135), Expect = 9.3e-09 Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TAIR10
Match: AT4G04695.1 (AT4G04695.1 calcium-dependent protein kinase 31) HSP 1 Score: 52.8 bits (125), Expect = 1.3e-07 Identity = 31/79 (39.24%), Postives = 41/79 (51.90%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TAIR10
Match: AT4G04720.1 (AT4G04720.1 calcium-dependent protein kinase 21) HSP 1 Score: 52.0 bits (123), Expect = 2.3e-07 Identity = 31/79 (39.24%), Postives = 41/79 (51.90%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TAIR10
Match: AT4G04700.1 (AT4G04700.1 calcium-dependent protein kinase 27) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 31/76 (40.79%), Postives = 44/76 (57.89%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. TAIR10
Match: AT3G51920.1 (AT3G51920.1 calmodulin 9) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 23/65 (35.38%), Postives = 40/65 (61.54%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. NCBI nr
Match: gi|700207392|gb|KGN62511.1| (hypothetical protein Csa_2G357340 [Cucumis sativus]) HSP 1 Score: 155.6 bits (392), Expect = 4.2e-35 Identity = 77/91 (84.62%), Postives = 84/91 (92.31%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. NCBI nr
Match: gi|700200028|gb|KGN55186.1| (hypothetical protein Csa_4G639740 [Cucumis sativus]) HSP 1 Score: 98.6 bits (244), Expect = 6.0e-18 Identity = 43/83 (51.81%), Postives = 62/83 (74.70%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. NCBI nr
Match: gi|700207393|gb|KGN62512.1| (hypothetical protein Csa_2G357350 [Cucumis sativus]) HSP 1 Score: 90.5 bits (223), Expect = 1.6e-15 Identity = 46/83 (55.42%), Postives = 56/83 (67.47%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. NCBI nr
Match: gi|659087772|ref|XP_008444628.1| (PREDICTED: probable calcium-binding protein CML18 [Cucumis melo]) HSP 1 Score: 90.1 bits (222), Expect = 2.1e-15 Identity = 47/69 (68.12%), Postives = 54/69 (78.26%), Query Frame = 1
BLAST of Cp4.1LG11g01520 vs. NCBI nr
Match: gi|700207394|gb|KGN62513.1| (hypothetical protein Csa_2G357850 [Cucumis sativus]) HSP 1 Score: 87.0 bits (214), Expect = 1.8e-14 Identity = 44/69 (63.77%), Postives = 54/69 (78.26%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|