MC03g0379.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCCAGATCCAGTACTCCGAAAAGTATTTCGACGATACCTATGAATACAGGTCTGTAATTTCTCATCCTCATCCGTTTTCCGATTCTCTGGCTTTTTCCGTCGGTATGGTTGATTTTGATGGTTTCTGTTTATGTCTGTGTAGGCATGTGGTGCTTCCCCCGGAAGTCGCTAAACTTCTCCCCAAGAATCGCCTTCTTTCCGAAGTAAGTACTAGTTCATGATTCTCCTGCGAAATCCAAGCCGAAACCCTAGCGGTTCCTTGATTTGATCATTTTCTTTAATCATGGACTGTTTTTTCTCCGATTGATTGTGATGATCTCTACGGTTTGAATTCTGCGTAATTTGATGATTTGCCTGACGATGAGCAGAACGAATGGCGGGCGATCGGGGTTCAGCAGAGCCGGGGATGGGTCCACTACGCAATCCATCGCCCAGAGCCGCACATTATGCTGTTCAGGAGGCCACTCAACTATCAGCAGCAGCAGGAGAATCAAGCGCAGCAGATTATGGCCAAG ATGGGCCAGATCCAGTACTCCGAAAAGTATTTCGACGATACCTATGAATACAGGCATGTGGTGCTTCCCCCGGAAGTCGCTAAACTTCTCCCCAAGAATCGCCTTCTTTCCGAAAACGAATGGCGGGCGATCGGGGTTCAGCAGAGCCGGGGATGGGTCCACTACGCAATCCATCGCCCAGAGCCGCACATTATGCTGTTCAGGAGGCCACTCAACTATCAGCAGCAGCAGGAGAATCAAGCGCAGCAGATTATGGCCAAG ATGGGCCAGATCCAGTACTCCGAAAAGTATTTCGACGATACCTATGAATACAGGCATGTGGTGCTTCCCCCGGAAGTCGCTAAACTTCTCCCCAAGAATCGCCTTCTTTCCGAAAACGAATGGCGGGCGATCGGGGTTCAGCAGAGCCGGGGATGGGTCCACTACGCAATCCATCGCCCAGAGCCGCACATTATGCTGTTCAGGAGGCCACTCAACTATCAGCAGCAGCAGGAGAATCAAGCGCAGCAGATTATGGCCAAG MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQIMAK Homology
BLAST of MC03g0379.1 vs. ExPASy Swiss-Prot
Match: O23249 (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CKS1 PE=1 SV=1) HSP 1 Score: 175.6 bits (444), Expect = 2.4e-43 Identity = 81/87 (93.10%), Postives = 85/87 (97.70%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy Swiss-Prot
Match: A2XCH8 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica OX=39946 GN=CKS1 PE=2 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 1.1e-40 Identity = 78/81 (96.30%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy Swiss-Prot
Match: Q6PS57 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CKS1 PE=2 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 1.1e-40 Identity = 78/81 (96.30%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy Swiss-Prot
Match: Q9SJJ5 (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CKS2 PE=1 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 1.8e-38 Identity = 72/80 (90.00%), Postives = 78/80 (97.50%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy Swiss-Prot
Match: P55933 (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum OX=5791 PE=1 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.2e-28 Identity = 53/66 (80.30%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of MC03g0379.1 vs. NCBI nr
Match: XP_022152941.1 (cyclin-dependent kinases regulatory subunit 1 [Momordica charantia]) HSP 1 Score: 182 bits (462), Expect = 5.84e-58 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of MC03g0379.1 vs. NCBI nr
Match: PIA54927.1 (hypothetical protein AQUCO_00901082v1 [Aquilegia coerulea]) HSP 1 Score: 181 bits (458), Expect = 2.38e-57 Identity = 85/87 (97.70%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of MC03g0379.1 vs. NCBI nr
Match: KAF5186146.1 (Cyclin-dependent kinases regulatory subunit [Thalictrum thalictroides]) HSP 1 Score: 179 bits (455), Expect = 6.83e-57 Identity = 85/87 (97.70%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of MC03g0379.1 vs. NCBI nr
Match: OVA17930.1 (Cyclin-dependent kinase [Macleaya cordata]) HSP 1 Score: 178 bits (451), Expect = 2.79e-56 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 0
BLAST of MC03g0379.1 vs. NCBI nr
Match: OMO84425.1 (Cyclin-dependent kinase, regulatory subunit [Corchorus capsularis] >OMO90372.1 Cyclin-dependent kinase, regulatory subunit [Corchorus olitorius]) HSP 1 Score: 177 bits (449), Expect = 5.80e-56 Identity = 83/86 (96.51%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy TrEMBL
Match: A0A6J1DJ87 (Cyclin-dependent kinases regulatory subunit OS=Momordica charantia OX=3673 GN=LOC111020553 PE=3 SV=1) HSP 1 Score: 182 bits (462), Expect = 2.83e-58 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy TrEMBL
Match: A0A2G5EH85 (Cyclin-dependent kinases regulatory subunit OS=Aquilegia coerulea OX=218851 GN=AQUCO_00901082v1 PE=3 SV=1) HSP 1 Score: 181 bits (458), Expect = 1.15e-57 Identity = 85/87 (97.70%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy TrEMBL
Match: A0A7J6VM11 (Cyclin-dependent kinases regulatory subunit OS=Thalictrum thalictroides OX=46969 GN=FRX31_024268 PE=3 SV=1) HSP 1 Score: 179 bits (455), Expect = 3.31e-57 Identity = 85/87 (97.70%), Postives = 87/87 (100.00%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy TrEMBL
Match: A0A200R5F3 (Cyclin-dependent kinases regulatory subunit OS=Macleaya cordata OX=56857 GN=BVC80_1835g330 PE=3 SV=1) HSP 1 Score: 178 bits (451), Expect = 1.35e-56 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 0
BLAST of MC03g0379.1 vs. ExPASy TrEMBL
Match: A0A1R3IPB4 (Cyclin-dependent kinases regulatory subunit OS=Corchorus capsularis OX=210143 GN=CCACVL1_10826 PE=3 SV=1) HSP 1 Score: 177 bits (449), Expect = 2.81e-56 Identity = 83/86 (96.51%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of MC03g0379.1 vs. TAIR 10
Match: AT2G27960.1 (cyclin-dependent kinase-subunit 1 ) HSP 1 Score: 175.6 bits (444), Expect = 1.7e-44 Identity = 81/87 (93.10%), Postives = 85/87 (97.70%), Query Frame = 0
BLAST of MC03g0379.1 vs. TAIR 10
Match: AT2G27970.1 (CDK-subunit 2 ) HSP 1 Score: 159.5 bits (402), Expect = 1.3e-39 Identity = 72/80 (90.00%), Postives = 78/80 (97.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|