Lsi09G006860 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAACGCGACGGCGACGGCGGCCGGCGATTCCGATTCTGACGTTTCTCAGCTTCCGATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCGCTAGGGCTTGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA ATGGAGAACGCGACGGCGACGGCGGCCGGCGATTCCGATTCTGACGTTTCTCAGCTTCCGATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCGCTAGGGCTTGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA ATGGAGAACGCGACGGCGACGGCGGCCGGCGATTCCGATTCTGACGTTTCTCAGCTTCCGATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCGCTAGGGCTTGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA MENATATAAGDSDSDVSQLPIHSQVEKIKKEIEKIKHPSLQQSEMNTHLLLRGISISKPRSRSPLGLAAERPISVGN
BLAST of Lsi09G006860 vs. TrEMBL
Match: A0A0A0KPB9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G561250 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.6e-23 Identity = 61/72 (84.72%), Postives = 66/72 (91.67%), Query Frame = 1
BLAST of Lsi09G006860 vs. TrEMBL
Match: A0A0D2RM82_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G156500 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.7e-09 Identity = 40/65 (61.54%), Postives = 47/65 (72.31%), Query Frame = 1
BLAST of Lsi09G006860 vs. TrEMBL
Match: B9HJF8_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s13370g PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.7e-09 Identity = 41/68 (60.29%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of Lsi09G006860 vs. TrEMBL
Match: A0A061E8X1_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_011040 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-08 Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 1
BLAST of Lsi09G006860 vs. TrEMBL
Match: A0A0D2QEK8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G172500 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-08 Identity = 42/76 (55.26%), Postives = 51/76 (67.11%), Query Frame = 1
BLAST of Lsi09G006860 vs. TAIR10
Match: AT1G67920.1 (AT1G67920.1 unknown protein) HSP 1 Score: 58.2 bits (139), Expect = 2.7e-09 Identity = 44/77 (57.14%), Postives = 49/77 (63.64%), Query Frame = 1
BLAST of Lsi09G006860 vs. TAIR10
Match: AT1G24600.1 (AT1G24600.1 unknown protein) HSP 1 Score: 53.9 bits (128), Expect = 5.0e-08 Identity = 36/58 (62.07%), Postives = 41/58 (70.69%), Query Frame = 1
BLAST of Lsi09G006860 vs. NCBI nr
Match: gi|659072795|ref|XP_008467101.1| (PREDICTED: uncharacterized protein LOC103504534 [Cucumis melo]) HSP 1 Score: 122.1 bits (305), Expect = 4.3e-25 Identity = 63/72 (87.50%), Postives = 69/72 (95.83%), Query Frame = 1
BLAST of Lsi09G006860 vs. NCBI nr
Match: gi|778703910|ref|XP_011655448.1| (PREDICTED: uncharacterized protein LOC105435535 [Cucumis sativus]) HSP 1 Score: 116.3 bits (290), Expect = 2.3e-23 Identity = 61/72 (84.72%), Postives = 66/72 (91.67%), Query Frame = 1
BLAST of Lsi09G006860 vs. NCBI nr
Match: gi|1009154831|ref|XP_015895384.1| (PREDICTED: uncharacterized protein LOC107429246 [Ziziphus jujuba]) HSP 1 Score: 68.2 bits (165), Expect = 7.3e-09 Identity = 44/77 (57.14%), Postives = 52/77 (67.53%), Query Frame = 1
BLAST of Lsi09G006860 vs. NCBI nr
Match: gi|823158187|ref|XP_012478961.1| (PREDICTED: uncharacterized protein LOC105794361 [Gossypium raimondii]) HSP 1 Score: 67.4 bits (163), Expect = 1.2e-08 Identity = 40/65 (61.54%), Postives = 47/65 (72.31%), Query Frame = 1
BLAST of Lsi09G006860 vs. NCBI nr
Match: gi|224099549|ref|XP_002311528.1| (hypothetical protein POPTR_0008s13370g [Populus trichocarpa]) HSP 1 Score: 67.4 bits (163), Expect = 1.2e-08 Identity = 41/68 (60.29%), Postives = 48/68 (70.59%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|