ClCG01G006530 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAACGCGACGGCGACGGCGACGGTGGCCAGCGATTCCGATTCTGACGTTTCTCAGCTTCCCATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCCCTAGGGCTCGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA ATGGAGAACGCGACGGCGACGGCGACGGTGGCCAGCGATTCCGATTCTGACGTTTCTCAGCTTCCCATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCCCTAGGGCTCGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA ATGGAGAACGCGACGGCGACGGCGACGGTGGCCAGCGATTCCGATTCTGACGTTTCTCAGCTTCCCATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCCCTAGGGCTCGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA MENATATATVASDSDSDVSQLPIHSQVEKIKKEIEKIKHPSLQQSEMNTHLLLRGISISKPRSRSPLGLAAERPISVGN
BLAST of ClCG01G006530 vs. TrEMBL
Match: A0A0A0KPB9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G561250 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.0e-24 Identity = 60/72 (83.33%), Postives = 65/72 (90.28%), Query Frame = 1
BLAST of ClCG01G006530 vs. TrEMBL
Match: A0A061E8X1_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_011040 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.8e-10 Identity = 43/78 (55.13%), Postives = 56/78 (71.79%), Query Frame = 1
BLAST of ClCG01G006530 vs. TrEMBL
Match: A0A0D2RM82_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G156500 PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.1e-09 Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of ClCG01G006530 vs. TrEMBL
Match: B9HJF8_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s13370g PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.0e-09 Identity = 40/67 (59.70%), Postives = 47/67 (70.15%), Query Frame = 1
BLAST of ClCG01G006530 vs. TrEMBL
Match: A0A067L0U5_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04753 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.0e-09 Identity = 40/64 (62.50%), Postives = 47/64 (73.44%), Query Frame = 1
BLAST of ClCG01G006530 vs. TAIR10
Match: AT1G67920.1 (AT1G67920.1 unknown protein) HSP 1 Score: 60.1 bits (144), Expect = 7.2e-10 Identity = 38/57 (66.67%), Postives = 39/57 (68.42%), Query Frame = 1
BLAST of ClCG01G006530 vs. TAIR10
Match: AT1G24600.1 (AT1G24600.1 unknown protein) HSP 1 Score: 56.6 bits (135), Expect = 8.0e-09 Identity = 39/71 (54.93%), Postives = 44/71 (61.97%), Query Frame = 1
BLAST of ClCG01G006530 vs. NCBI nr
Match: gi|659072795|ref|XP_008467101.1| (PREDICTED: uncharacterized protein LOC103504534 [Cucumis melo]) HSP 1 Score: 125.2 bits (313), Expect = 5.2e-26 Identity = 62/72 (86.11%), Postives = 68/72 (94.44%), Query Frame = 1
BLAST of ClCG01G006530 vs. NCBI nr
Match: gi|778703910|ref|XP_011655448.1| (PREDICTED: uncharacterized protein LOC105435535 [Cucumis sativus]) HSP 1 Score: 119.4 bits (298), Expect = 2.8e-24 Identity = 60/72 (83.33%), Postives = 65/72 (90.28%), Query Frame = 1
BLAST of ClCG01G006530 vs. NCBI nr
Match: gi|590696774|ref|XP_007045256.1| (Uncharacterized protein TCM_011040 [Theobroma cacao]) HSP 1 Score: 72.4 bits (176), Expect = 4.0e-10 Identity = 43/78 (55.13%), Postives = 56/78 (71.79%), Query Frame = 1
BLAST of ClCG01G006530 vs. NCBI nr
Match: gi|1009154831|ref|XP_015895384.1| (PREDICTED: uncharacterized protein LOC107429246 [Ziziphus jujuba]) HSP 1 Score: 70.5 bits (171), Expect = 1.5e-09 Identity = 40/59 (67.80%), Postives = 47/59 (79.66%), Query Frame = 1
BLAST of ClCG01G006530 vs. NCBI nr
Match: gi|823158187|ref|XP_012478961.1| (PREDICTED: uncharacterized protein LOC105794361 [Gossypium raimondii]) HSP 1 Score: 70.5 bits (171), Expect = 1.5e-09 Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |