Cla97C01G006840 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAACGCGACGGCGACGGCGACGGTGGCCAGCGATTCCGATTCTGACGTTTCTCAGCTTCCCATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCCCTAGGGCTCGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA ATGGAGAACGCGACGGCGACGGCGACGGTGGCCAGCGATTCCGATTCTGACGTTTCTCAGCTTCCCATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCCCTAGGGCTCGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA ATGGAGAACGCGACGGCGACGGCGACGGTGGCCAGCGATTCCGATTCTGACGTTTCTCAGCTTCCCATTCACAGCCAAGTTGAGAAGATCAAGAAGGAGATTGAGAAGATCAAGCATCCTTCCCTTCAGCAATCCGAGATGAACACTCACCTTCTTCTTCGCGGTATCTCGATTTCGAAGCCGCGATCTCGCTCTCCCCTAGGGCTCGCCGCCGAGAGGCCTATTTCCGTCGGGAATTAA MENATATATVASDSDSDVSQLPIHSQVEKIKKEIEKIKHPSLQQSEMNTHLLLRGISISKPRSRSPLGLAAERPISVGN
BLAST of Cla97C01G006840 vs. NCBI nr
Match: XP_016903705.1 (PREDICTED: uncharacterized protein LOC103504534 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 1.5e-21 Identity = 56/62 (90.32%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of Cla97C01G006840 vs. NCBI nr
Match: XP_011655448.1 (PREDICTED: uncharacterized protein LOC105435535 [Cucumis sativus] >KGN51465.1 hypothetical protein Csa_5G561250 [Cucumis sativus]) HSP 1 Score: 107.5 bits (267), Expect = 2.2e-20 Identity = 55/62 (88.71%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of Cla97C01G006840 vs. NCBI nr
Match: XP_022146403.1 (uncharacterized protein LOC111015628 [Momordica charantia]) HSP 1 Score: 104.4 bits (259), Expect = 1.8e-19 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of Cla97C01G006840 vs. NCBI nr
Match: XP_023523054.1 (uncharacterized protein LOC111787191 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 100.5 bits (249), Expect = 2.7e-18 Identity = 52/61 (85.25%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Cla97C01G006840 vs. NCBI nr
Match: XP_022921904.1 (uncharacterized protein LOC111430025 isoform X1 [Cucurbita moschata]) HSP 1 Score: 99.4 bits (246), Expect = 5.9e-18 Identity = 51/61 (83.61%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Cla97C01G006840 vs. TrEMBL
Match: tr|A0A1S4E6T1|A0A1S4E6T1_CUCME (uncharacterized protein LOC103504534 OS=Cucumis melo OX=3656 GN=LOC103504534 PE=4 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.0e-21 Identity = 56/62 (90.32%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of Cla97C01G006840 vs. TrEMBL
Match: tr|A0A0A0KPB9|A0A0A0KPB9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G561250 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.4e-20 Identity = 55/62 (88.71%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of Cla97C01G006840 vs. TrEMBL
Match: tr|A0A1R3GRJ3|A0A1R3GRJ3_COCAP (Uncharacterized protein OS=Corchorus capsularis OX=210143 GN=CCACVL1_23951 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 9.7e-09 Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 0
BLAST of Cla97C01G006840 vs. TrEMBL
Match: tr|A0A1R3JGN0|A0A1R3JGN0_9ROSI (Uncharacterized protein OS=Corchorus olitorius OX=93759 GN=COLO4_16580 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 9.7e-09 Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 0
BLAST of Cla97C01G006840 vs. TrEMBL
Match: tr|A0A2P5WS48|A0A2P5WS48_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_AA26760 PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.3e-08 Identity = 41/59 (69.49%), Postives = 47/59 (79.66%), Query Frame = 0
BLAST of Cla97C01G006840 vs. TAIR10
Match: AT1G67920.1 (unknown protein) HSP 1 Score: 57.8 bits (138), Expect = 3.6e-09 Identity = 38/57 (66.67%), Postives = 41/57 (71.93%), Query Frame = 0
BLAST of Cla97C01G006840 vs. TAIR10
Match: AT1G24600.1 (unknown protein) HSP 1 Score: 53.9 bits (128), Expect = 5.2e-08 Identity = 36/58 (62.07%), Postives = 41/58 (70.69%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|