MELO3C018592 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGTGCCAAGCAGCGAGTCAAACACGATTTCGGGCATTGAAACATGAAAATGGGATTGCTGGGAAGCCAACAATTATTGTTAAAGTGATAGCATGTTTTCAACCTTTGCAGAATTGCCAGGTATCCACAGCTTGGTTTCTAAACCCTATAAATGGTCAATTAATTTCGGTACTGAATATCATTGACTCCTGGAACTATATGGTTAACCTTCCTGTGGAATTTTTTTTTTAACAGGCTGAGTACTTCCGTCATTTGCTCAAACCTGTCACGTAG ATGGTGTGCCAAGCAGCGAGTCAAACACGATTTCGGGCATTGAAACATGAAAATGGGATTGCTGGGAAGCCAACAATTATTGTTAAAGTGATAGCATGTTTTCAACCTTTGCAGAATTGCCAGGCTGAGTACTTCCGTCATTTGCTCAAACCTGTCACGTAG ATGGTGTGCCAAGCAGCGAGTCAAACACGATTTCGGGCATTGAAACATGAAAATGGGATTGCTGGGAAGCCAACAATTATTGTTAAAGTGATAGCATGTTTTCAACCTTTGCAGAATTGCCAGGCTGAGTACTTCCGTCATTTGCTCAAACCTGTCACGTAG MVCQAASQTRFRALKHENGIAGKPTIIVKVIACFQPLQNCQAEYFRHLLKPVT*
BLAST of MELO3C018592 vs. TrEMBL
Match: A0A0A0K458_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G066260 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 2.2e-22 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of MELO3C018592 vs. TrEMBL
Match: W9R7U4_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_011398 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 1.8e-21 Identity = 51/53 (96.23%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of MELO3C018592 vs. TrEMBL
Match: A0A0B0MJS2_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_26115 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 9.1e-21 Identity = 48/53 (90.57%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of MELO3C018592 vs. TrEMBL
Match: A0A0D2RD15_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G224400 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 9.1e-21 Identity = 48/53 (90.57%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of MELO3C018592 vs. TrEMBL
Match: A0A0A0KVT2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G113180 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 2.6e-20 Identity = 49/53 (92.45%), Postives = 52/53 (98.11%), Query Frame = 1
BLAST of MELO3C018592 vs. TAIR10
Match: AT5G50011.1 (AT5G50011.1 conserved peptide upstream open reading frame 37) HSP 1 Score: 86.3 bits (212), Expect = 6.4e-18 Identity = 41/53 (77.36%), Postives = 44/53 (83.02%), Query Frame = 1
BLAST of MELO3C018592 vs. TAIR10
Match: AT5G09461.1 (AT5G09461.1 conserved peptide upstream open reading frame 43) HSP 1 Score: 83.2 bits (204), Expect = 5.4e-17 Identity = 38/54 (70.37%), Postives = 44/54 (81.48%), Query Frame = 1
BLAST of MELO3C018592 vs. TAIR10
Match: AT5G64341.1 (AT5G64341.1 conserved peptide upstream open reading frame 40) HSP 1 Score: 78.6 bits (192), Expect = 1.3e-15 Identity = 35/53 (66.04%), Postives = 41/53 (77.36%), Query Frame = 1
BLAST of MELO3C018592 vs. NCBI nr
Match: gi|700188536|gb|KGN43769.1| (hypothetical protein Csa_7G066260 [Cucumis sativus]) HSP 1 Score: 112.1 bits (279), Expect = 3.1e-22 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of MELO3C018592 vs. NCBI nr
Match: gi|703093100|ref|XP_010094825.1| (hypothetical protein L484_011398 [Morus notabilis]) HSP 1 Score: 109.0 bits (271), Expect = 2.6e-21 Identity = 51/53 (96.23%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of MELO3C018592 vs. NCBI nr
Match: gi|728817163|gb|KHG02368.1| (hypothetical protein F383_26115 [Gossypium arboreum]) HSP 1 Score: 106.7 bits (265), Expect = 1.3e-20 Identity = 48/53 (90.57%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of MELO3C018592 vs. NCBI nr
Match: gi|763760272|gb|KJB27526.1| (hypothetical protein B456_005G224400 [Gossypium raimondii]) HSP 1 Score: 106.7 bits (265), Expect = 1.3e-20 Identity = 48/53 (90.57%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of MELO3C018592 vs. NCBI nr
Match: gi|700198577|gb|KGN53735.1| (hypothetical protein Csa_4G113180 [Cucumis sativus]) HSP 1 Score: 105.1 bits (261), Expect = 3.8e-20 Identity = 49/53 (92.45%), Postives = 52/53 (98.11%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|