Lsi09G014690 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAAGCTATTTGGTTTTTCATTGACGGCTAGTACTACTGATAGAGCGAACTTGGGTGCGCCATGTTCGAACCACAACAAGAGATTCGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAATTCTCAAGCCCTCGGCGGCCACCAGAACGCTCACAAGCGCGAGCGCCAGCTCGCTAAACAACTACTTCCTTTCCAACCCTCTAAACACTCTCGTAATTTTTTAAATTCTACATCGTCTTTGCCGCCGCCCTCCGCTGCCGTGATCTGGTCCGCTGGAAGAGCTCCGCCGCTGGAATATGGGATGTCGATGCAAGCACCGCCGTTGGTTGGCGGTGGCAATGTGAATGGAGAAAGTAATGGCGTTGATCTCCACCTCAGTCTCGCACCTTCCTCTTAA ATGATGAAGCTATTTGGTTTTTCATTGACGGCTAGTACTACTGATAGAGCGAACTTGGGTGCGCCATGTTCGAACCACAACAAGAGATTCGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAATTCTCAAGCCCTCGGCGGCCACCAGAACGCTCACAAGCGCGAGCGCCAGCTCGCTAAACAACTACTTCCTTTCCAACCCTCTAAACACTCTCGTAATTTTTTAAATTCTACATCGTCTTTGCCGCCGCCCTCCGCTGCCGTGATCTGGTCCGCTGGAAGAGCTCCGCCGCTGGAATATGGGATGTCGATGCAAGCACCGCCGTTGGTTGGCGGTGGCAATGTGAATGGAGAAAGTAATGGCGTTGATCTCCACCTCAGTCTCGCACCTTCCTCTTAA ATGATGAAGCTATTTGGTTTTTCATTGACGGCTAGTACTACTGATAGAGCGAACTTGGGTGCGCCATGTTCGAACCACAACAAGAGATTCGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAATTCTCAAGCCCTCGGCGGCCACCAGAACGCTCACAAGCGCGAGCGCCAGCTCGCTAAACAACTACTTCCTTTCCAACCCTCTAAACACTCTCGTAATTTTTTAAATTCTACATCGTCTTTGCCGCCGCCCTCCGCTGCCGTGATCTGGTCCGCTGGAAGAGCTCCGCCGCTGGAATATGGGATGTCGATGCAAGCACCGCCGTTGGTTGGCGGTGGCAATGTGAATGGAGAAAGTAATGGCGTTGATCTCCACCTCAGTCTCGCACCTTCCTCTTAA MMKLFGFSLTASTTDRANLGAPCSNHNKRFECQFCGREFANSQALGGHQNAHKRERQLAKQLLPFQPSKHSRNFLNSTSSLPPPSAAVIWSAGRAPPLEYGMSMQAPPLVGGGNVNGESNGVDLHLSLAPSS
BLAST of Lsi09G014690 vs. Swiss-Prot
Match: ZFP6_ARATH (Zinc finger protein 6 OS=Arabidopsis thaliana GN=ZFP6 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.5e-11 Identity = 45/114 (39.47%), Postives = 62/114 (54.39%), Query Frame = 1
BLAST of Lsi09G014690 vs. Swiss-Prot
Match: ZFP8_ARATH (Zinc finger protein 8 OS=Arabidopsis thaliana GN=ZFP8 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.7e-10 Identity = 45/112 (40.18%), Postives = 55/112 (49.11%), Query Frame = 1
BLAST of Lsi09G014690 vs. Swiss-Prot
Match: ZFP5_ARATH (Zinc finger protein 5 OS=Arabidopsis thaliana GN=ZFP5 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-09 Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 1
BLAST of Lsi09G014690 vs. Swiss-Prot
Match: GIS_ARATH (Zinc finger protein GIS OS=Arabidopsis thaliana GN=GIS PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-09 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 1
BLAST of Lsi09G014690 vs. Swiss-Prot
Match: GIS2_ARATH (Zinc finger protein GIS2 OS=Arabidopsis thaliana GN=GIS2 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 3.6e-08 Identity = 32/68 (47.06%), Postives = 38/68 (55.88%), Query Frame = 1
BLAST of Lsi09G014690 vs. TrEMBL
Match: A0A0A0KI02_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G312040 PE=4 SV=1) HSP 1 Score: 206.8 bits (525), Expect = 1.6e-50 Identity = 108/136 (79.41%), Postives = 114/136 (83.82%), Query Frame = 1
BLAST of Lsi09G014690 vs. TrEMBL
Match: A0A067KMC9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13000 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.1e-11 Identity = 61/178 (34.27%), Postives = 84/178 (47.19%), Query Frame = 1
BLAST of Lsi09G014690 vs. TrEMBL
Match: A0A067K6I8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_18960 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 60/152 (39.47%), Postives = 79/152 (51.97%), Query Frame = 1
BLAST of Lsi09G014690 vs. TrEMBL
Match: A0A151RXK5_CAJCA (Zinc finger protein 6 OS=Cajanus cajan GN=KK1_031078 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 60/147 (40.82%), Postives = 74/147 (50.34%), Query Frame = 1
BLAST of Lsi09G014690 vs. TrEMBL
Match: A0A0A0KRQ5_CUCSA (Multicellular trichome development C2H2 zinc finger transcription factor OS=Cucumis sativus GN=Gl-3 PE=2 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 68/191 (35.60%), Postives = 89/191 (46.60%), Query Frame = 1
BLAST of Lsi09G014690 vs. TAIR10
Match: AT1G67030.1 (AT1G67030.1 zinc finger protein 6) HSP 1 Score: 69.3 bits (168), Expect = 2.0e-12 Identity = 45/114 (39.47%), Postives = 62/114 (54.39%), Query Frame = 1
BLAST of Lsi09G014690 vs. TAIR10
Match: AT2G41940.1 (AT2G41940.1 zinc finger protein 8) HSP 1 Score: 64.7 bits (156), Expect = 4.9e-11 Identity = 45/112 (40.18%), Postives = 55/112 (49.11%), Query Frame = 1
BLAST of Lsi09G014690 vs. TAIR10
Match: AT1G10480.1 (AT1G10480.1 zinc finger protein 5) HSP 1 Score: 64.3 bits (155), Expect = 6.4e-11 Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 1
BLAST of Lsi09G014690 vs. TAIR10
Match: AT3G58070.1 (AT3G58070.1 C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 64.3 bits (155), Expect = 6.4e-11 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 1
BLAST of Lsi09G014690 vs. TAIR10
Match: AT1G68360.1 (AT1G68360.1 C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 59.3 bits (142), Expect = 2.1e-09 Identity = 35/85 (41.18%), Postives = 48/85 (56.47%), Query Frame = 1
BLAST of Lsi09G014690 vs. NCBI nr
Match: gi|700192197|gb|KGN47401.1| (hypothetical protein Csa_6G312040 [Cucumis sativus]) HSP 1 Score: 206.8 bits (525), Expect = 2.3e-50 Identity = 108/136 (79.41%), Postives = 114/136 (83.82%), Query Frame = 1
BLAST of Lsi09G014690 vs. NCBI nr
Match: gi|449464754|ref|XP_004150094.1| (PREDICTED: zinc finger protein 6-like [Cucumis sativus]) HSP 1 Score: 204.9 bits (520), Expect = 8.6e-50 Identity = 107/135 (79.26%), Postives = 113/135 (83.70%), Query Frame = 1
BLAST of Lsi09G014690 vs. NCBI nr
Match: gi|659117022|ref|XP_008458383.1| (PREDICTED: zinc finger protein 6-like [Cucumis melo]) HSP 1 Score: 193.7 bits (491), Expect = 2.0e-46 Identity = 102/136 (75.00%), Postives = 111/136 (81.62%), Query Frame = 1
BLAST of Lsi09G014690 vs. NCBI nr
Match: gi|672175470|ref|XP_008807788.1| (PREDICTED: zinc finger protein 6-like [Phoenix dactylifera]) HSP 1 Score: 87.8 bits (216), Expect = 1.5e-14 Identity = 59/150 (39.33%), Postives = 75/150 (50.00%), Query Frame = 1
BLAST of Lsi09G014690 vs. NCBI nr
Match: gi|743868952|ref|XP_010905700.1| (PREDICTED: zinc finger protein 6-like [Elaeis guineensis]) HSP 1 Score: 82.8 bits (203), Expect = 4.9e-13 Identity = 58/149 (38.93%), Postives = 73/149 (48.99%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |