Cucsa.069470 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGCTGTTTGGTTTTTCAGTGACGGCTAGTACTACGTCTACTGATGGAGCCACCAACTTGGGTGCGCCATGTCCGAACCACAACAAGAGATTTGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAACTCTCAAGCCCTTGGTGGCCACCAGAACGCACACAAGCGCGAGCGCCAGCTCGCCAAGCAATTACTCCCTCTCCAACCCACTAAACACTCTCGTAACTTTTTAGCTTCCACGCCGCCTTCGTCTACTGTCGGAATCTGGTCGGCGGGTAGAGCTCCACCACCGAAATATGGGATCCAGGTACAAGCGAGGCCGGCGGTGGTTGGCGGCGGGGAAGTTAACAGGGAAA ATGAAGCTGTTTGGTTTTTCAGTGACGGCTAGTACTACGTCTACTGATGGAGCCACCAACTTGGGTGCGCCATGTCCGAACCACAACAAGAGATTTGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAACTCTCAAGCCCTTGGTGGCCACCAGAACGCACACAAGCGCGAGCGCCAGCTCGCCAAGCAATTACTCCCTCTCCAACCCACTAAACACTCTCGTAACTTTTTAGCTTCCACGCCGCCTTCGTCTACTGTCGGAATCTGGTCGGCGGGTAGAGCTCCACCACCGAAATATGGGATCCAGGTACAAGCGAGGCCGGCGGTGGTTGGCGGCGGGGAAGTTAACAGGGAAA ATGAAGCTGTTTGGTTTTTCAGTGACGGCTAGTACTACGTCTACTGATGGAGCCACCAACTTGGGTGCGCCATGTCCGAACCACAACAAGAGATTTGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAACTCTCAAGCCCTTGGTGGCCACCAGAACGCACACAAGCGCGAGCGCCAGCTCGCCAAGCAATTACTCCCTCTCCAACCCACTAAACACTCTCGTAACTTTTTAGCTTCCACGCCGCCTTCGTCTACTGTCGGAATCTGGTCGGCGGGTAGAGCTCCACCACCGAAATATGGGATCCAGGTACAAGCGAGGCCGGCGGTGGTTGGCGGCGGGGAAGTTAACAGGGAAA MKLFGFSVTASTTSTDGATNLGAPCPNHNKRFECQFCGREFANSQALGGHQNAHKRERQLAKQLLPLQPTKHSRNFLASTPPSSTVGIWSAGRAPPPKYGIQVQARPAVVGGGEVNREX
BLAST of Cucsa.069470 vs. Swiss-Prot
Match: ZFP6_ARATH (Zinc finger protein 6 OS=Arabidopsis thaliana GN=ZFP6 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 39/86 (45.35%), Postives = 53/86 (61.63%), Query Frame = 1
BLAST of Cucsa.069470 vs. Swiss-Prot
Match: ZFP5_ARATH (Zinc finger protein 5 OS=Arabidopsis thaliana GN=ZFP5 PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 5.4e-11 Identity = 38/79 (48.10%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Cucsa.069470 vs. Swiss-Prot
Match: GIS_ARATH (Zinc finger protein GIS OS=Arabidopsis thaliana GN=GIS PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.7e-10 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 1
BLAST of Cucsa.069470 vs. Swiss-Prot
Match: ZFP8_ARATH (Zinc finger protein 8 OS=Arabidopsis thaliana GN=ZFP8 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.0e-09 Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = 1
BLAST of Cucsa.069470 vs. Swiss-Prot
Match: GIS2_ARATH (Zinc finger protein GIS2 OS=Arabidopsis thaliana GN=GIS2 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.9e-09 Identity = 32/68 (47.06%), Postives = 39/68 (57.35%), Query Frame = 1
BLAST of Cucsa.069470 vs. TrEMBL
Match: A0A0A0KI02_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G312040 PE=4 SV=1) HSP 1 Score: 247.7 bits (631), Expect = 7.3e-63 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1
BLAST of Cucsa.069470 vs. TrEMBL
Match: A0A0D2LRB1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G241300 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.4e-12 Identity = 44/114 (38.60%), Postives = 58/114 (50.88%), Query Frame = 1
BLAST of Cucsa.069470 vs. TrEMBL
Match: A0A161X640_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_007252 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.4e-12 Identity = 52/133 (39.10%), Postives = 74/133 (55.64%), Query Frame = 1
BLAST of Cucsa.069470 vs. TrEMBL
Match: A0A067KMC9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13000 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.8e-12 Identity = 42/88 (47.73%), Postives = 58/88 (65.91%), Query Frame = 1
BLAST of Cucsa.069470 vs. TrEMBL
Match: F6H746_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0077g01390 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.3e-11 Identity = 58/153 (37.91%), Postives = 73/153 (47.71%), Query Frame = 1
BLAST of Cucsa.069470 vs. TAIR10
Match: AT1G67030.1 (AT1G67030.1 zinc finger protein 6) HSP 1 Score: 73.6 bits (179), Expect = 9.5e-14 Identity = 39/86 (45.35%), Postives = 53/86 (61.63%), Query Frame = 1
BLAST of Cucsa.069470 vs. TAIR10
Match: AT1G10480.1 (AT1G10480.1 zinc finger protein 5) HSP 1 Score: 68.6 bits (166), Expect = 3.1e-12 Identity = 38/79 (48.10%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Cucsa.069470 vs. TAIR10
Match: AT1G68360.1 (AT1G68360.1 C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 67.4 bits (163), Expect = 6.8e-12 Identity = 48/140 (34.29%), Postives = 66/140 (47.14%), Query Frame = 1
BLAST of Cucsa.069470 vs. TAIR10
Match: AT3G58070.1 (AT3G58070.1 C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 66.2 bits (160), Expect = 1.5e-11 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 1
BLAST of Cucsa.069470 vs. TAIR10
Match: AT2G41940.1 (AT2G41940.1 zinc finger protein 8) HSP 1 Score: 62.8 bits (151), Expect = 1.7e-10 Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = 1
BLAST of Cucsa.069470 vs. NCBI nr
Match: gi|449464754|ref|XP_004150094.1| (PREDICTED: zinc finger protein 6-like [Cucumis sativus]) HSP 1 Score: 247.7 bits (631), Expect = 1.0e-62 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1
BLAST of Cucsa.069470 vs. NCBI nr
Match: gi|700192197|gb|KGN47401.1| (hypothetical protein Csa_6G312040 [Cucumis sativus]) HSP 1 Score: 247.7 bits (631), Expect = 1.0e-62 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1
BLAST of Cucsa.069470 vs. NCBI nr
Match: gi|659117022|ref|XP_008458383.1| (PREDICTED: zinc finger protein 6-like [Cucumis melo]) HSP 1 Score: 219.9 bits (559), Expect = 2.3e-54 Identity = 105/118 (88.98%), Postives = 111/118 (94.07%), Query Frame = 1
BLAST of Cucsa.069470 vs. NCBI nr
Match: gi|1009128827|ref|XP_015881443.1| (PREDICTED: zinc finger protein 6 [Ziziphus jujuba]) HSP 1 Score: 85.1 bits (209), Expect = 8.9e-14 Identity = 47/103 (45.63%), Postives = 67/103 (65.05%), Query Frame = 1
BLAST of Cucsa.069470 vs. NCBI nr
Match: gi|1009163361|ref|XP_015899926.1| (PREDICTED: zinc finger protein 6-like [Ziziphus jujuba]) HSP 1 Score: 79.7 bits (195), Expect = 3.8e-12 Identity = 41/67 (61.19%), Postives = 47/67 (70.15%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|