Csa6G312040 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAAGCTGTTTGGTTTTTCAGTGACGGCTAGTACTACGTCTACTGATGGAGCCACCAACTTGGGTGCGCCATGTCCGAACCACAACAAGAGATTTGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAACTCTCAAGCCCTTGGTGGCCACCAGAACGCACACAAGCGCGAGCGCCAGCTCGCCAAGCAATTACTCCCTCTCCAACCCACTAAACACTCTCGTAACTTTTTAGCTTCCACGCCGCCTTCGTCTACTGTCGGAATCTGGTCGGCGGGTAGAGCTCCACCACCGAAATATGGGATCCAGGTACAAGCGAGGCCGGCGGTGGTTGGCGGCGGGGAAGTTAACAGGGAAAGTAATGGCGTTGATCTCCACCTCAGTCTCGCACCTTCATCGGGCAGGATTTTCTGTTAAGTGAAGTATTGTTTTTTCTTTTCTTTTTTTTTTTTAACAATTTCCTTCCAAAGCAGAATTGTGTTAAACTGTTGAATGGAAAATTGGGAGGAAAGTGTTTGGAATTTGATCGATTATTATGAATGGAAATTATGATACATGGAATACTACCAATTTTCTC ATGATGAAGCTGTTTGGTTTTTCAGTGACGGCTAGTACTACGTCTACTGATGGAGCCACCAACTTGGGTGCGCCATGTCCGAACCACAACAAGAGATTTGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAACTCTCAAGCCCTTGGTGGCCACCAGAACGCACACAAGCGCGAGCGCCAGCTCGCCAAGCAATTACTCCCTCTCCAACCCACTAAACACTCTCGTAACTTTTTAGCTTCCACGCCGCCTTCGTCTACTGTCGGAATCTGGTCGGCGGGTAGAGCTCCACCACCGAAATATGGGATCCAGGTACAAGCGAGGCCGGCGGTGGTTGGCGGCGGGGAAGTTAACAGGGAAAGTAATGGCGTTGATCTCCACCTCAGTCTCGCACCTTCATCGGGCAGGATTTTCTGTTAA ATGATGAAGCTGTTTGGTTTTTCAGTGACGGCTAGTACTACGTCTACTGATGGAGCCACCAACTTGGGTGCGCCATGTCCGAACCACAACAAGAGATTTGAGTGCCAATTCTGCGGCCGTGAGTTCGCCAACTCTCAAGCCCTTGGTGGCCACCAGAACGCACACAAGCGCGAGCGCCAGCTCGCCAAGCAATTACTCCCTCTCCAACCCACTAAACACTCTCGTAACTTTTTAGCTTCCACGCCGCCTTCGTCTACTGTCGGAATCTGGTCGGCGGGTAGAGCTCCACCACCGAAATATGGGATCCAGGTACAAGCGAGGCCGGCGGTGGTTGGCGGCGGGGAAGTTAACAGGGAAAGTAATGGCGTTGATCTCCACCTCAGTCTCGCACCTTCATCGGGCAGGATTTTCTGTTAA MMKLFGFSVTASTTSTDGATNLGAPCPNHNKRFECQFCGREFANSQALGGHQNAHKRERQLAKQLLPLQPTKHSRNFLASTPPSSTVGIWSAGRAPPPKYGIQVQARPAVVGGGEVNRESNGVDLHLSLAPSSGRIFC*
BLAST of Csa6G312040 vs. Swiss-Prot
Match: ZFP6_ARATH (Zinc finger protein 6 OS=Arabidopsis thaliana GN=ZFP6 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 2.0e-12 Identity = 39/86 (45.35%), Postives = 51/86 (59.30%), Query Frame = 1
BLAST of Csa6G312040 vs. Swiss-Prot
Match: ZFP5_ARATH (Zinc finger protein 5 OS=Arabidopsis thaliana GN=ZFP5 PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 6.3e-11 Identity = 38/79 (48.10%), Postives = 48/79 (60.76%), Query Frame = 1
BLAST of Csa6G312040 vs. Swiss-Prot
Match: GIS_ARATH (Zinc finger protein GIS OS=Arabidopsis thaliana GN=GIS PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 3.1e-10 Identity = 28/37 (75.68%), Postives = 30/37 (81.08%), Query Frame = 1
BLAST of Csa6G312040 vs. Swiss-Prot
Match: ZFP8_ARATH (Zinc finger protein 8 OS=Arabidopsis thaliana GN=ZFP8 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.5e-09 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = 1
BLAST of Csa6G312040 vs. Swiss-Prot
Match: GIS2_ARATH (Zinc finger protein GIS2 OS=Arabidopsis thaliana GN=GIS2 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.5e-09 Identity = 32/68 (47.06%), Postives = 37/68 (54.41%), Query Frame = 1
BLAST of Csa6G312040 vs. TrEMBL
Match: A0A0A0KI02_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G312040 PE=4 SV=1) HSP 1 Score: 287.7 bits (735), Expect = 7.4e-75 Identity = 138/138 (100.00%), Postives = 138/138 (100.00%), Query Frame = 1
BLAST of Csa6G312040 vs. TrEMBL
Match: F6H746_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0077g01390 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 2.3e-15 Identity = 69/177 (38.98%), Postives = 85/177 (48.02%), Query Frame = 1
BLAST of Csa6G312040 vs. TrEMBL
Match: K4AWE5_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 3.1e-12 Identity = 51/141 (36.17%), Postives = 73/141 (51.77%), Query Frame = 1
BLAST of Csa6G312040 vs. TrEMBL
Match: A0A067K6I8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_18960 PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 3.1e-12 Identity = 64/157 (40.76%), Postives = 75/157 (47.77%), Query Frame = 1
BLAST of Csa6G312040 vs. TrEMBL
Match: A0A0D2LRB1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G241300 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 4.0e-12 Identity = 44/114 (38.60%), Postives = 58/114 (50.88%), Query Frame = 1
BLAST of Csa6G312040 vs. TAIR10
Match: AT1G67030.1 (AT1G67030.1 zinc finger protein 6) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-13 Identity = 39/86 (45.35%), Postives = 51/86 (59.30%), Query Frame = 1
BLAST of Csa6G312040 vs. TAIR10
Match: AT1G10480.1 (AT1G10480.1 zinc finger protein 5) HSP 1 Score: 68.6 bits (166), Expect = 3.6e-12 Identity = 38/79 (48.10%), Postives = 48/79 (60.76%), Query Frame = 1
BLAST of Csa6G312040 vs. TAIR10
Match: AT1G68360.1 (AT1G68360.1 C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 67.4 bits (163), Expect = 8.0e-12 Identity = 48/140 (34.29%), Postives = 64/140 (45.71%), Query Frame = 1
BLAST of Csa6G312040 vs. TAIR10
Match: AT3G58070.1 (AT3G58070.1 C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 66.2 bits (160), Expect = 1.8e-11 Identity = 28/37 (75.68%), Postives = 30/37 (81.08%), Query Frame = 1
BLAST of Csa6G312040 vs. TAIR10
Match: AT2G41940.1 (AT2G41940.1 zinc finger protein 8) HSP 1 Score: 62.8 bits (151), Expect = 2.0e-10 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = 1
BLAST of Csa6G312040 vs. NCBI nr
Match: gi|700192197|gb|KGN47401.1| (hypothetical protein Csa_6G312040 [Cucumis sativus]) HSP 1 Score: 287.7 bits (735), Expect = 1.1e-74 Identity = 138/138 (100.00%), Postives = 138/138 (100.00%), Query Frame = 1
BLAST of Csa6G312040 vs. NCBI nr
Match: gi|449464754|ref|XP_004150094.1| (PREDICTED: zinc finger protein 6-like [Cucumis sativus]) HSP 1 Score: 285.8 bits (730), Expect = 4.0e-74 Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 1
BLAST of Csa6G312040 vs. NCBI nr
Match: gi|659117022|ref|XP_008458383.1| (PREDICTED: zinc finger protein 6-like [Cucumis melo]) HSP 1 Score: 251.9 bits (642), Expect = 6.5e-64 Identity = 122/136 (89.71%), Postives = 128/136 (94.12%), Query Frame = 1
BLAST of Csa6G312040 vs. NCBI nr
Match: gi|731388268|ref|XP_010649539.1| (PREDICTED: zinc finger protein 6-like [Vitis vinifera]) HSP 1 Score: 90.1 bits (222), Expect = 3.2e-15 Identity = 69/177 (38.98%), Postives = 85/177 (48.02%), Query Frame = 1
BLAST of Csa6G312040 vs. NCBI nr
Match: gi|743868952|ref|XP_010905700.1| (PREDICTED: zinc finger protein 6-like [Elaeis guineensis]) HSP 1 Score: 82.4 bits (202), Expect = 6.8e-13 Identity = 57/148 (38.51%), Postives = 70/148 (47.30%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|