Lsi04G005260 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATATTATAATAATTGTGAGAGCAAAGGAATTGGGAAGGTGAAGTGGCAGAGGAGAGGGAGGCGCGGCGGACGGCACGGCGGCGGCTCAATCCAAATCAAGATGAGAAAGCTGCAGCGGCTTATCCCCGGAGGGCGGAGGCTGAAACCGGACCGGCTATTCTTGAAAACCGCTGATTATATAATGCAATTGAGGTCTCAAGTTCATGTTTTGCAAGCACTTTCCAAGATTTATGATCCTAGGCTTTCTTAA ATGGAATATTATAATAATTGTGAGAGCAAAGGAATTGGGAAGGTGAAGTGGCAGAGGAGAGGGAGGCGCGGCGGACGGCACGGCGGCGGCTCAATCCAAATCAAGATGAGAAAGCTGCAGCGGCTTATCCCCGGAGGGCGGAGGCTGAAACCGGACCGGCTATTCTTGAAAACCGCTGATTATATAATGCAATTGAGGTCTCAAGTTCATGTTTTGCAAGCACTTTCCAAGATTTATGATCCTAGGCTTTCTTAA ATGGAATATTATAATAATTGTGAGAGCAAAGGAATTGGGAAGGTGAAGTGGCAGAGGAGAGGGAGGCGCGGCGGACGGCACGGCGGCGGCTCAATCCAAATCAAGATGAGAAAGCTGCAGCGGCTTATCCCCGGAGGGCGGAGGCTGAAACCGGACCGGCTATTCTTGAAAACCGCTGATTATATAATGCAATTGAGGTCTCAAGTTCATGTTTTGCAAGCACTTTCCAAGATTTATGATCCTAGGCTTTCTTAA MEYYNNCESKGIGKVKWQRRGRRGGRHGGGSIQIKMRKLQRLIPGGRRLKPDRLFLKTADYIMQLRSQVHVLQALSKIYDPRLS
BLAST of Lsi04G005260 vs. TrEMBL
Match: A0A0A0KQB4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G602220 PE=4 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 8.5e-34 Identity = 75/86 (87.21%), Postives = 80/86 (93.02%), Query Frame = 1
BLAST of Lsi04G005260 vs. TrEMBL
Match: A0A0D2UY55_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G343700 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 8.9e-15 Identity = 46/77 (59.74%), Postives = 57/77 (74.03%), Query Frame = 1
BLAST of Lsi04G005260 vs. TrEMBL
Match: A0A0D2SJD6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G184100 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.7e-14 Identity = 43/79 (54.43%), Postives = 60/79 (75.95%), Query Frame = 1
BLAST of Lsi04G005260 vs. TrEMBL
Match: A0A067GSA5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g037825mg PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.9e-13 Identity = 43/71 (60.56%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of Lsi04G005260 vs. TrEMBL
Match: K7L9K5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_08G289300 PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.8e-12 Identity = 42/71 (59.15%), Postives = 56/71 (78.87%), Query Frame = 1
BLAST of Lsi04G005260 vs. TAIR10
Match: AT1G23965.1 (AT1G23965.1 unknown protein) HSP 1 Score: 65.9 bits (159), Expect = 1.4e-11 Identity = 39/73 (53.42%), Postives = 50/73 (68.49%), Query Frame = 1
BLAST of Lsi04G005260 vs. TAIR10
Match: AT1G70270.1 (AT1G70270.1 unknown protein) HSP 1 Score: 49.3 bits (116), Expect = 1.4e-06 Identity = 27/58 (46.55%), Postives = 40/58 (68.97%), Query Frame = 1
BLAST of Lsi04G005260 vs. NCBI nr
Match: gi|778705118|ref|XP_011655641.1| (PREDICTED: transcription factor PAR2 [Cucumis sativus]) HSP 1 Score: 150.6 bits (379), Expect = 1.2e-33 Identity = 75/86 (87.21%), Postives = 80/86 (93.02%), Query Frame = 1
BLAST of Lsi04G005260 vs. NCBI nr
Match: gi|659090850|ref|XP_008446236.1| (PREDICTED: uncharacterized protein LOC103489026 [Cucumis melo]) HSP 1 Score: 146.0 bits (367), Expect = 3.0e-32 Identity = 74/87 (85.06%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of Lsi04G005260 vs. NCBI nr
Match: gi|802788017|ref|XP_012092068.1| (PREDICTED: transcription factor PAR1 [Jatropha curcas]) HSP 1 Score: 94.7 bits (234), Expect = 8.0e-17 Identity = 50/77 (64.94%), Postives = 61/77 (79.22%), Query Frame = 1
BLAST of Lsi04G005260 vs. NCBI nr
Match: gi|823216320|ref|XP_012440878.1| (PREDICTED: transcription factor PAR1-like [Gossypium raimondii]) HSP 1 Score: 87.4 bits (215), Expect = 1.3e-14 Identity = 46/77 (59.74%), Postives = 57/77 (74.03%), Query Frame = 1
BLAST of Lsi04G005260 vs. NCBI nr
Match: gi|823159182|ref|XP_012479422.1| (PREDICTED: transcription factor PAR1-like [Gossypium raimondii]) HSP 1 Score: 84.7 bits (208), Expect = 8.2e-14 Identity = 43/79 (54.43%), Postives = 60/79 (75.95%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |